Record in detail


General Info

  • lamp_id:L01A000056
  • Name:PYY2_BOVIN
  • FullName:Caltrin
  • Source:Bos taurus
  • Mass:5566.3 Da
  • Sequence Length:48 aa
  • Isoelectric Point:11.62
  • Activity:Antibacterial, Antifungal
  • Sequence
        SDEKASPDRHHRFSLSRYAKLANRLSKWIGNRGNRLANPKLLETFKSV
  • Function:Inhibits calcium transport into spermatozoa; it does not bind directly to calcium. Binds to calmodulin. Inhibits the growth of microorganisms. Seem to act as an antibiotic by permeabilizing the bacterial membrane.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000056    From 1 To 48 E-value: 2e-23 Score: 99
        SDEKASPDRHHRFSLSRYAKLANRLSKWIGNRGNRLANPKLLETFKSV
  • 2. L03A000196    From 33 To 77 E-value: 0.0000000000005 Score: 65.1
        SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNR
  • 3. L01A000335    From 1 To 45 E-value: 0.000000000001 Score: 63.9
        SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNR
  • 4. L02A000234    From 1 To 45 E-value: 0.000000000001 Score: 63.9
        SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNR
  • 5. L13A022822    From 1 To 23 E-value: 0.0004 Score: 35.4
        SLSRYAKLANRL-----------ANPKLLETFLS

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Scheit K.H.,Theil R.,
  •   Title:Amino acid sequence of seminalplasmin, an antimicrobial protein from bull semen.
  •   Journal:EMBO J., 1983, 2, 1159-1163  [PubMed:16453469]
  •   [2]  Lardy H.A.,Kruggel W.,San Agustin J.,Lewis R.V.,
  •   Title:The structure of caltrin, the calcium-transport inhibitor of bovine seminal plasma.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 1985, 82, 6490-6491  [MEDLINE:86016727]
  •   [3]  Bhargava P.M.,Kumari V.K.,Sitaram N.,
  •   Title:Seminalplasmin and caltrin are the same protein.
  •   Journal:FEBS Lett., 1986, 201, 233-236  [MEDLINE:86220812]
  •   [4]  Scheit K.H.,Freudenstein J.,Wagner S.,
  •   Title:Characterization by cDNA cloning of the mRNA for seminalplasmin, the major basic protein of bull semen.
  •   Journal:DNA Cell Biol., 1990, 9, 437-442  [MEDLINE:91000358]
  •   [5]  Scheit K.H.,Preuss K.D.,Krauhs E.,
  •   Title:Functional properties of peptides derived from seminalplasmin: binding to monospecific anti-seminalplasmin immunoglobulins G and calmodulin.
  •   Journal:Biol. Chem. Hoppe-Seyler, 1990, 371, 111-115  [MEDLINE:90241472]
  •   [6]  Scheit K.K.,Kleine Kuhlmann J.,
  •   Title:Characterization of the gene for seminalplasmin, a secretory protein of the bovine seminal vesicle.
  •   Journal:Biochim. Biophys. Acta, 1993, 1173, 85-86  [MEDLINE:93250053]
  •   [7]  Nagaraj R.,Sitaram N.,
  •   Title:Seminal plasmin.
  •   Journal:Bioessays, 1995, 17, 415-422  [MEDLINE:95305850]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: