Record in detail
General Info
- lamp_id:L01A000056
- Name:PYY2_BOVIN
- FullName:Caltrin
- Source:Bos taurus
- Mass:5566.3 Da
- Sequence Length:48 aa
- Isoelectric Point:11.62
- Activity:Antibacterial, Antifungal
- Sequence
SDEKASPDRHHRFSLSRYAKLANRLSKWIGNRGNRLANPKLLETFKSV - Function:Inhibits calcium transport into spermatozoa; it does not bind directly to calcium. Binds to calmodulin. Inhibits the growth of microorganisms. Seem to act as an antibiotic by permeabilizing the bacterial membrane.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ51
- 2 Database:dbAMP dbAMP_10931
- 3 Database:SATPdb satpdb12094
- 4 Database:Uniprot P06833
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000056 From 1 To 48 E-value: 2e-23 Score: 99
SDEKASPDRHHRFSLSRYAKLANRLSKWIGNRGNRLANPKLLETFKSV - 2. L03A000196 From 33 To 77 E-value: 0.0000000000005 Score: 65.1
SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNR - 3. L01A000335 From 1 To 45 E-value: 0.000000000001 Score: 63.9
SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNR - 4. L02A000234 From 1 To 45 E-value: 0.000000000001 Score: 63.9
SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNR - 5. L13A022822 From 1 To 23 E-value: 0.0004 Score: 35.4
SLSRYAKLANRL-----------ANPKLLETFLS
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Scheit K.H.,Theil R.,
- Title:Amino acid sequence of seminalplasmin, an antimicrobial protein from bull semen.
- Journal:EMBO J., 1983, 2, 1159-1163 [PubMed:16453469]
- [2] Lardy H.A.,Kruggel W.,San Agustin J.,Lewis R.V.,
- Title:The structure of caltrin, the calcium-transport inhibitor of bovine seminal plasma.
- Journal:Proc. Natl. Acad. Sci. U.S.A., 1985, 82, 6490-6491 [MEDLINE:86016727]
- [3] Bhargava P.M.,Kumari V.K.,Sitaram N.,
- Title:Seminalplasmin and caltrin are the same protein.
- Journal:FEBS Lett., 1986, 201, 233-236 [MEDLINE:86220812]
- [4] Scheit K.H.,Freudenstein J.,Wagner S.,
- Title:Characterization by cDNA cloning of the mRNA for seminalplasmin, the major basic protein of bull semen.
- Journal:DNA Cell Biol., 1990, 9, 437-442 [MEDLINE:91000358]
- [5] Scheit K.H.,Preuss K.D.,Krauhs E.,
- Title:Functional properties of peptides derived from seminalplasmin: binding to monospecific anti-seminalplasmin immunoglobulins G and calmodulin.
- Journal:Biol. Chem. Hoppe-Seyler, 1990, 371, 111-115 [MEDLINE:90241472]
- [6] Scheit K.K.,Kleine Kuhlmann J.,
- Title:Characterization of the gene for seminalplasmin, a secretory protein of the bovine seminal vesicle.
- Journal:Biochim. Biophys. Acta, 1993, 1173, 85-86 [MEDLINE:93250053]
- [7] Nagaraj R.,Sitaram N.,
- Title:Seminal plasmin.
- Journal:Bioessays, 1995, 17, 415-422 [MEDLINE:95305850]
Comments
- Comments
No comments found on LAMP database