Record in detail


General Info

  • lamp_id:L01A000060
  • Name:CEC4_MANSE
  • FullName:Bactericidin B-4
  • Source:Manduca sexta
  • Mass:3862.4 Da
  • Sequence Length:37 aa
  • Isoelectric Point:11.3
  • Activity:Antibacterial
  • Sequence
        WNPFKELERAGQRVRDAIISAAPAVATVGQAAAIARG
  • Function:Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000060    From 1 To 37 E-value: 0.000000000000001 Score: 73.2
        WNPFKELERAGQRVRDAIISAAPAVATVGQAAAIARG
  • 2. L01A000058    From 1 To 37 E-value: 0.000000000000002 Score: 72.8
        WNPFKELERAGQRVRDAVISAAPAVATVGQAAAIARG
  • 3. L01A000059    From 1 To 37 E-value: 0.000000000000004 Score: 72
        WNPFKELERAGQRVRDAIISAGPAVATVGQAAAIARG
  • 4. L03A000218    From 25 To 60 E-value: 0.0000000000001 Score: 66.6
        WNPFKELERAGQRVRDAVISAA-AVATVGQAAAIARG
  • 5. L12A07817|    From 25 To 61 E-value: 0.0000000000002 Score: 66.2
        WNPFKELEKAGQRVRDAIISAAPAVEVVGQASSILKG

Structure

  •   Domains
  •   1  Name:Cecropin    Interpro Link:IPR000875
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Dunn P.E.,Russel V.,Dickinson L.,
  •   Title:A family of bacteria-regulated, cecropin D-like peptides from Manduca sexta.
  •   Journal:J. Biol. Chem., 1988, 263, 19424-19429  [MEDLINE:89066759]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: