Record in detail

lamp_id:L01A000062
Name:CECA_HYACE
FullName:Cecropin-A
Source:Hyalophora cecropia
Mass:4004.8 Da
Sequence Length:37 aa
Isoelectric Point:11.18
Activity:Antibacterial,Anticancer
Sequence
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
Function:Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Top similar AMPs on LAMP
1. L03A000212 From 27 To 63 E-value: 0.000000000000001 Score: 73.6
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
2. L01A000062 From 1 To 37 E-value: 0.000000000000003 Score: 72.4
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
3. L07APD0027 From 1 To 37 E-value: 0.000000000000003 Score: 72
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
4. L11A002257 From 1 To 37 E-value: 0.00000000000002 Score: 69.7
KWKLFKKIEKVGQNIRDGIIKAGPAVAWVGQATQIAK
5. L11A010351 From 1 To 37 E-value: 0.00000000000004 Score: 68.2
KWKFFKKIERVGQNIRDGIIKAGPAVAVVGQATNIAK

Antibacterial Activities
1 Target: E. coli D21 LC: 0.76 μg/ml (0.189772 μM)
2 Target: E. coli D31 LC: 0.84 μg/ml (0.209748 μM)
3 Target: Serratia marcescens Db11 LC: 16.82 μg/ml (4.19996 μM)
4 Target: Serratia marcescens Db1108 LC: 10.01 μg/ml (2.4995 μM)
5 Target: Serratia marcescens Db1121 LC: 17.62 μg/ml (4.39972 μM)
6 Target: Serratia marcescens Strain 122 LC: 12.82 μg/ml (3.20116 μM)
7 Target: P. aeruginosa OT97 LC: 19.22 μg/ml (4.79924 μM)
8 Target: Xenorhabdus nematophilus Xn21 LC: 5.61 μg/ml (1.40082 μM)
9 Target: Bacillus megaterium Bmll LC: 2.8 μg/ml (0.699161 μM)
10 Target: B. subtilis Bs11 LC: 244.29 μg/ml (60.9993 μM)
11 Target: B. thuringiensis Bt11 MIC: 320.38 μg/ml (79.999 μM)
12 Target: Streptococcus fecalis AD-4 LC: 60.07 μg/ml (14.9995 μM)
13 Target: Streptococcus fecalis DS16 LC: 296.36 μg/ml (74.0012 μM)
14 Target: Micrococcus luteus M111 LC: 18.42 μg/ml (4.59948 μM)

Reference
[1] Boman H.G.,Bennich H.,Engstroem A.,Hultmark D.,Steiner H.,
Title:Sequence and specificity of two antibacterial proteins involved in insect immunity.
Journal:Nature, 1981, 292, 246-248 [MEDLINE:81245158]
[2] Boman H.G.,Kapur R.,Bennich H.,Engstroem A.,Hultmark D.,
Title:Insect immunity: isolation and structure of cecropin D and four minor antibacterial components from Cecropia pupae.
Journal:Eur. J. Biochem., 1982, 127, 207-217 [MEDLINE:83053366]
[3] Boman H.G.,Xanthopoulos K.G.,Gudmundsson G.H.,Lidholm D.-A.,
Title:Insect immunity: cDNA clones coding for the precursor forms of cecropins A and D, antibacterial proteins from Hyalophora cecropia.
Journal:FEBS Lett., 1987, 226, 8-12 [:]
[4] Bennich H.,Lindeberg G.,Kraulis P.J.,Engstroem A.,Holak T.A.,
Title:The solution conformation of the antibacterial peptide cecropin A: a nuclear magnetic resonance and dynamical simulated annealing study.
Journal:Biochemistry, 1988, 27, 7620-7629 [MEDLINE:89088132]
[5] Boman H.G.,Gan R.,Aasling B.,Lidholm D.-A.,Gudmundsson G.H.,
Title:The cecropin locus. Cloning and expression of a gene cluster encoding three antibacterial peptides in Hyalophora cecropia.
Journal:J. Biol. Chem., 1991, 266, 11510-11517 [MEDLINE:91268009]