Record in detail

lamp_id:L01A000063
Name:CECB_ANTPE
FullName:Cecropin-B
Source:Antheraea pernyi
Mass:3817.6 Da
Sequence Length:35 aa
Isoelectric Point:11.49
Activity:Antibacterial,Anticancer
Sequence
KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL
Function:Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Top similar AMPs on LAMP
1. L01A000063 From 1 To 35 E-value: 0.00000000000009 Score: 67.4
KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL
2. L03A000213 From 27 To 61 E-value: 0.0000000000002 Score: 66.2
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL
3. L13A022492 From 3 To 37 E-value: 0.0000000000003 Score: 65.9
KWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKAL
4. L13A023961 From 1 To 34 E-value: 0.0000000000003 Score: 65.5
KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKA
5. L01A000064 From 1 To 35 E-value: 0.0000000000005 Score: 64.7
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL

Antibacterial Activities
1 Target: Escherichia coli D21 MIC: 1.37 μg/ml (0.358864 μM)
2 Target: Escherichia coli D31 MIC: 1.15 μg/ml (0.301236 μM)
3 Target: Serratia marsescens MIC: 9.93 μg/ml (2.60111 μM)
4 Target: Serratia marsescens Strain 122 MIC: 45.81 μg/ml (11.9997 μM)
5 Target: Pseudomonas aeruginosa OT97 MIC: 11.07 μg/ml (2.89973 μM)
6 Target: Xenorhabdus nematophilus Xn21 MIC: 6.11 μg/ml (1.60048 μM)
7 Target: Bacillus subtilis Bsll MIC: 64.9 μg/ml (17.0002 μM)
8 Target: Bacillus megaterium Bmll MIC: 2.44 μg/ml (0.639145 μM)
9 Target: Bacillus thuringiensis Btll MIC: 335.95 μg/ml (88.0003 μM)
10 Target: Streptococcus fecalis Ds16 MIC: 335.95 μg/ml (88.0003 μM)
11 Target: Streptococcus fecalis AD-4 MIC: 335.95 μg/ml (88.0003 μM)
12 Target: Micrococcus luteus MI11 MIC: 1.11 μg/ml (0.290759 μM)

Reference
[1] Boman H.G.,Bennich H.,Engstroem A.,Steiner H.,Qu X.-M.,
Title:Insect immunity: isolation and structure of cecropins B and D from pupae of the Chinese oak silk moth, Antheraea pernyi.
Journal:Eur. J. Biochem., 1982, 127, 219-224 [MEDLINE:83053368]
[2] Kamensky I.,Bennich H.,Engstrom A.,Craig A.G.,
Title:Plasma desorption mass spectrometry coupled with conventional peptide sequencing techniques.
Journal:Biomed. Environ. Mass Spectrom., 1987, 14, 669-673 [MEDLINE:88108273]