Record in detail


General Info

  • lamp_id:L01A000064
  • Name:CECB_HYACE
  • FullName:Cecropin-B
  • Source:Hyalophora cecropia
  • Mass:3835.7 Da
  • Sequence Length:35 aa
  • Isoelectric Point:11.49
  • Activity:Antibacterial
  • Sequence
        KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL
  • Function:Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000213    From 27 To 61 E-value: 0.00000000000002 Score: 69.7
        KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL
  • 2. L01A000064    From 1 To 35 E-value: 0.00000000000004 Score: 68.6
        KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL
  • 3. L01A001114    From 1 To 35 E-value: 0.00000000000005 Score: 68.2
        KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL
  • 4. L13A028862    From 1 To 35 E-value: 0.00000000000007 Score: 67.8
        KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAI
  • 5. L13A011163    From 1 To 35 E-value: 0.00000000000007 Score: 67.8
        KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAI

Structure

  •   Domains
  •   1  Name:Cecropin    Interpro Link:IPR000875
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Refer :7140755 E. coli D21  LC:  1.23 μg/ml  (0.320672 μM)  
  •   2  Target:  E. coli D31  LC:  1.23 μg/ml  (0.320672 μM)  
  •   3  Target:  Serratia marcescens Db11  LC:  17.26 μg/ml  (4.49983 μM)  
  •   4  Target:  Serratia marcescens Db1108  LC:  9.21 μg/ml  (2.40113 μM)  
  •   5  Target:  Serratia marcescens Db1121  LC:  8.44 μg/ml  (2.20038 μM)  
  •   6  Target:  Serratia marcescens Strain 122  LC:  11.12 μg/ml  (2.89908 μM)  
  •   7  Target:  P. aeruginosa OT97  LC:  7.29 μg/ml  (1.90057 μM)  
  •   8  Target:  Xenorhabdus nematophilus Xn21  LC:  6.14 μg/ml  (1.60075 μM)  
  •   9  Target:  Bacillus megaterium Bmll  LC:  1.69 μg/ml  (0.440598 μM)  
  •   10  Target:  B. subtilis Bs11  LC:  69.04 μg/ml  (17.9993 μM)  
  •   11  Target:  B. thuringiensis Bt11  LC:  510.15 μg/ml  (133 μM)  
  •   12  Target:  Streptococcus fecalis AD-4  LC:  28 μg/ml  (7.29984 μM)  
  •   13  Target:  Streptococcus fecalis DS16  LC:  92.06 μg/ml  (24.0008 μM)  
  •   14  Target:  Micrococcus luteus M111  LC:  4.99 μg/ml  (1.30094 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Boman H.G.,Bennich H.,Engstroem A.,Hultmark D.,Steiner H.,
  •   Title:Sequence and specificity of two antibacterial proteins involved in insect immunity.
  •   Journal:Nature, 1981, 292, 246-248  [MEDLINE:81245158]
  •   [2]  Xanthopoulos K.G.,Lee J.-Y.,Kockum K.,Faye I.,van Hofsten P.,
  •   Title:Molecular cloning, cDNA sequencing, and chemical synthesis of cecropin B from Hyalophora cecropia.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 1985, 82, 2240-2243  [MEDLINE:85190472]
  •   [3]  Lee J.-Y.,Kockum K.,von Hofsten P.,Faye I.,Boman H.G.,
  •   Title:On the primary structures of lysozyme, cecropins and attacins from Hyalophora cecropia.
  •   Journal:Dev. Comp. Immunol., 1985, 9, 551-558  [MEDLINE:86005745]
  •   [4]  Faye I.,Kockum K.,Gan R.,Lee J.-Y.,Xanthopoulos G.,
  •   Title:The structure of the gene for cecropin B, an antibacterial immune protein from Hyalophora cecropia.
  •   Journal:Eur. J. Biochem., 1988, 172, 371-376  [MEDLINE:88166708]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: