Record in detail


General Info

  • lamp_id:L01A000065
  • Name:CECD_ANTPE
  • FullName:Cecropin-D
  • Source:Antheraea pernyi
  • Mass:3807.3 Da
  • Sequence Length:36 aa
  • Isoelectric Point:10.76
  • Activity:Antibacterial
  • Sequence
        WNPFKELERAGQRVRDAIISAGPAVATVAQATALAK
  • Function:Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08755|    From 25 To 60 E-value: 0.000000000000001 Score: 73.9
        WNPFKELERAGQRVRDAIISAGPAVATVAQATALAK
  • 2. L12A08757|    From 25 To 60 E-value: 0.000000000000001 Score: 73.6
        WNPFKELERAGQRVRDAIISAGPAVATVAQATALAK
  • 3. L01A000065    From 1 To 36 E-value: 0.000000000000002 Score: 72.8
        WNPFKELERAGQRVRDAIISAGPAVATVAQATALAK
  • 4. L01A000059    From 1 To 36 E-value: 0.0000000000001 Score: 67
        WNPFKELERAGQRVRDAIISAGPAVATVGQAAAIAR
  • 5. L01A000060    From 1 To 36 E-value: 0.0000000000006 Score: 64.7
        WNPFKELERAGQRVRDAIISAAPAVATVGQAAAIAR

Structure

  •   Domains
  •   1  Name:Cecropin    Interpro Link:IPR000875
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli D21 D11  MIC:  1.41 μg/ml  (0.370341 μM)  
  •   2  Target:  Escherichia coli D31D21  MIC:  0.8 μg/ml  (0.210123 μM)  
  •   3  Target:  Serratia marsescens Dbl108 Dbll  MIC:  23.22 μg/ml  (6.09881 μM)  
  •   4  Target:  Strain 122  MIC:  285.55 μg/ml  (75.0007 μM)  
  •   5  Target:  Pseudomonas aeruginosa OT97  MIC:  308.39 μg/ml  (80.9997 μM)  
  •   6  Target:  Xenorhabdus nematophilus Xn2 1  MIC:  60.92 μg/ml  (16.0008 μM)  
  •   7  Target:  Bacillus subtilis Bsll  MIC:  308.39 μg/ml  (80.9997 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Boman H.G.,Bennich H.,Engstroem A.,Steiner H.,Qu X.-M.,
  •   Title:Insect immunity: isolation and structure of cecropins B and D from pupae of the Chinese oak silk moth, Antheraea pernyi.
  •   Journal:Eur. J. Biochem., 1982, 127, 219-224  [MEDLINE:83053368]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: