Record in detail


General Info

  • lamp_id:L01A000071
  • Name:DFB12_BOVIN
  • FullName:Beta-defensin 12
  • Source:Bos taurus
  • Mass:4105.9 Da
  • Sequence Length:38 aa
  • Isoelectric Point:9.28
  • Activity:Antibacterial
  • Sequence
        GPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW
  • Function:Has bactericidal activity. Active against E.coli ML35 and S.aureus 502A.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000261    From 23 To 60 E-value: 1e-17 Score: 80.1
        GPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW
  • 2. L01A000072    From 5 To 42 E-value: 9e-17 Score: 77.4
        GPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW
  • 3. L01A000071    From 1 To 38 E-value: 1e-16 Score: 76.6
        GPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW
  • 4. L12A09071|    From 27 To 64 E-value: 2e-16 Score: 75.9
        GPLSCGRNGGVCIPIRCPVPMRQIGTCFRRPVKCCRSW
  • 5. L12A00451|    From 1 To 38 E-value: 3e-16 Score: 75.9
        APLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

Activity

  •   Antibacterial Activities
  •   1  Target:  S. aureus  MIC:  10 μg/ml  (2.43552 μM)  
  •   2  Target:  E. coli  MIC:  10 μg/ml  (2.43552 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Selsted M.E.,Tang Y.-Q.,
  •   Title:Characterization of the disulfide motif in BNBD-12, an antimicrobial beta-defensin peptide from bovine neutrophils.
  •   Journal:J. Biol. Chem., 1993, 268, 6649-6653  [MEDLINE:93203265]
  •   [2]  Novotny M.J.,McGuire P.A.,Morris W.L.,Tang Y.-Q.,Selsted M.E.,
  •   Title:Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils.
  •   Journal:J. Biol. Chem., 1993, 268, 6641-6648  [MEDLINE:93203264]
  •   [3]  Pardi A.,Selsted M.E.,Legault P.,Zimmermann G.R.,
  •   Title:Solution structure of bovine neutrophil beta-defensin-12: the peptide fold of the beta-defensins is identical to that of the classical defensins.
  •   Journal:Biochemistry, 1995, 34, 13663-13671  [MEDLINE:96027485]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: