Record in detail


General Info

  • lamp_id:L01A000072
  • Name:DFB13_BOVIN
  • FullName:Beta-defensin 13
  • Source:Bos taurus
  • Mass:4450.3 Da
  • Sequence Length:42 aa
  • Isoelectric Point:9.28
  • Activity:Antibacterial
  • Sequence
        SGISGPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW
  • Function:Has bactericidal activity. Active against E.coli ML35 and S.aureus 502A.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000261    From 19 To 60 E-value: 1e-19 Score: 86.7
        SGISGPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW
  • 2. L01A000072    From 1 To 42 E-value: 1e-18 Score: 83.6
        SGISGPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW
  • 3. L12A09071|    From 23 To 64 E-value: 6e-18 Score: 81.3
        QGISGPLSCGRNGGVCIPIRCPVPMRQIGTCFRRPVKCCRSW
  • 4. L12A09080|    From 19 To 60 E-value: 3e-17 Score: 79
        SGISGPLSCRRNGGVCIPIRCPGPMRQIGTCFGRPVKCCRSW
  • 5. L12A02357|    From 3 To 44 E-value: 8e-17 Score: 77.4
        QGISGPLSCRRNGGVCIPIRCPGPMRQIGTCFGRPVKCCRSW

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  S. aureus  MIC:  10 μg/ml  (2.24704 μM)  
  •   2  Target:  E. coli  MIC:  10 μg/ml  (2.24704 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Novotny M.J.,McGuire P.A.,Morris W.L.,Tang Y.-Q.,Selsted M.E.,
  •   Title:Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils.
  •   Journal:J. Biol. Chem., 1993, 268, 6641-6648  [MEDLINE:93203264]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: