Record in detail


General Info

  • lamp_id:L01A000074
  • Name:DEFI_PALPR
  • FullName:Defensin
  • Source:Palomena prasina
  • Mass:4648.3 Da
  • Sequence Length:43 aa
  • Isoelectric Point:8.63
  • Activity:Antibacterial
  • Sequence
        ATCDALSFSSKWLTVNHSACAIHCLTKGYKGGRCVNTICNCRN
  • Function:Antibacterial peptide active against Gram-positive and Gram-negative bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000074    From 1 To 43 E-value: 2e-20 Score: 89.4
        ATCDALSFSSKWLTVNHSACAIHCLTKGYKGGRCVNTICNCRN
  • 2. L01A000575    From 1 To 43 E-value: 0.0000000000005 Score: 64.7
        ATCDILSFQSQWVTPNHAGCALHCVIKGYKGGQCKITVCHCRR
  • 3. L03A000129    From 52 To 94 E-value: 0.0000000000008 Score: 63.9
        ATCDLFSFRSKWVTPNHAACAAHCLLRGNRGGRCKGTICHCRK
  • 4. L05ADEF491    From 1 To 43 E-value: 0.000000000001 Score: 63.2
        ASCDLFSFSSQWVTPNDSVCAAHCLVKGYKGGSCKNKICHCRD
  • 5. L05ADEF457    From 2 To 43 E-value: 0.000000000001 Score: 63.2
        TCDLLSFSSKIFSFNHSACAAHCLAKRKKGGRCVNGVCRCRN

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Bulet P.,Hetru C.,Briand J.-P.,Cociancich S.,Chernysh S.,
  •   Title:The inducible antibacterial peptides of the hemipteran insect Palomena prasina: identification of a unique family of proline-rich peptides and of a novel insect defensin.
  •   Journal:J. Insect Physiol., 1996, 42, 81-89  [DOI:10.1016/0022-1910(95)00085-2]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: