Record in detail
General Info
- lamp_id:L01A000074
- Name:DEFI_PALPR
- FullName:Defensin
- Source:Palomena prasina
- Mass:4648.3 Da
- Sequence Length:43 aa
- Isoelectric Point:8.63
- Activity:Antibacterial
- Sequence
ATCDALSFSSKWLTVNHSACAIHCLTKGYKGGRCVNTICNCRN - Function:Antibacterial peptide active against Gram-positive and Gram-negative bacteria.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ1180
- 2 Database:dbAMP dbAMP_00599
- 3 Database:DRAMP DRAMP03316
- 4 Database:SATPdb satpdb25265
- 5 Database:Uniprot P80407
- 6 Database:AMD DEFI_PALPR
- 7 Database:DEF DEF134
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000074 From 1 To 43 E-value: 2e-20 Score: 89.4
ATCDALSFSSKWLTVNHSACAIHCLTKGYKGGRCVNTICNCRN - 2. L01A000575 From 1 To 43 E-value: 0.0000000000005 Score: 64.7
ATCDILSFQSQWVTPNHAGCALHCVIKGYKGGQCKITVCHCRR - 3. L03A000129 From 52 To 94 E-value: 0.0000000000008 Score: 63.9
ATCDLFSFRSKWVTPNHAACAAHCLLRGNRGGRCKGTICHCRK - 4. L05ADEF491 From 1 To 43 E-value: 0.000000000001 Score: 63.2
ASCDLFSFSSQWVTPNDSVCAAHCLVKGYKGGSCKNKICHCRD - 5. L05ADEF457 From 2 To 43 E-value: 0.000000000001 Score: 63.2
TCDLLSFSSKIFSFNHSACAAHCLAKRKKGGRCVNGVCRCRN
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Bulet P.,Hetru C.,Briand J.-P.,Cociancich S.,Chernysh S.,
- Title:The inducible antibacterial peptides of the hemipteran insect Palomena prasina: identification of a unique family of proline-rich peptides and of a novel insect defensin.
- Journal:J. Insect Physiol., 1996, 42, 81-89 [DOI:10.1016/0022-1910(95)00085-2]
Comments
- Comments
No comments found on LAMP database