Record in detail


General Info

  • lamp_id:L01A000075
  • Name:DMYC_DROME
  • FullName:Drosomycin
  • Source:Drosophila melanogaster
  • Mass:4897.5 Da
  • Sequence Length:44 aa
  • Isoelectric Point:7.64
  • Activity:Antifungal
  • Sequence
        DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC
  • Function:Possesses antifungal activity and is active against a relatively broad spectrum of filamentous fungi. It inhibits spore germination at high concentrations and at low concentrations delays growth of hyphae which subsequently exhibit abnormal morphology. Spz C-106 in the hemolymph controls expression of the antifungal peptide by acting as a ligand of Tl and inducing an intracellular signaling pathway.

Cross-Linking

  •   Cross-linking
  •   1  Database:APD  672
  •   2  Database:CAMP  CAMPSQ68
  •   3  Database:DBAASP  461
  •   4  Database:dbAMP  dbAMP_00987
  •   5  Database:DRAMP  DRAMP03093
  •   6  Database:SATPdb  satpdb25108
  •   7  Database:Uniprot  P41964
  •   8  Database:DEF  DEF388

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000197    From 27 To 70 E-value: 5e-22 Score: 94.7
        DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC
  • 2. L01A000075    From 1 To 44 E-value: 1e-20 Score: 90.5
        DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC
  • 3. L13A022558    From 1 To 43 E-value: 5e-20 Score: 88.2
        CLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC
  • 4. L02A001551    From 1 To 44 E-value: 8e-19 Score: 84
        DCLSGKYKGPCAVWDNEMCRRICKEEGHISGHCSPSLKCWCEGC
  • 5. L01A002966    From 28 To 71 E-value: 0.0000000000001 Score: 67
        DCLSGTFKGPCWAWSGEKCRRLCIEEGRVSGHCSGGSKCWCEGC

Structure

  •   Domains
  •   1  Name:Gamma-thionin    Interpro Link:IPR008176
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

Activity

  •   Antibacterial Activities
  •   1  Target:  N. crassa  IC50:  2.94 μg/ml  (0.600306 μM)  
  •   2  Target:  B. cinerea  IC50:  5.88 μg/ml  (1.20061 μM)  
  •   3  Target:  F. culmorum  IC50:  4.9 μg/ml  (1.00051 μM)  
  •   4  Target:  A. brassicola  IC50:  4.41 μg/ml  (0.900459 μM)  
  •   5  Target:  N . haematococca  IC50:  8.82 μg/ml  (1.80092 μM)  
  •   6  Target:  F. oxysporum  IC50:  20.57 μg/ml  (4.2001 μM)  
  •   7  Target:  A. pisi  IC50:  15.67 μg/ml  (3.19959 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Broekaert W.F.,Lagueux M.,Michaut L.,Bulet P.,Fehlbaum P.,
  •   Title:Insect immunity. Septic injury of Drosophila induces the synthesis of a potent antifungal peptide with sequence homology to plant antifungal peptides.
  •   Journal:J. Biol. Chem., 1994, 269, 33159-33163  [MEDLINE:95105209]
  •   [2]  Hoffmann J.A.,Reichhart J.-M.,Michaut L.,Nicolas E.,Lemaitre B.,
  •   Title:The dorsoventral regulatory gene cassette spatzle/Toll/cactus controls the potent antifungal response in Drosophila adults.
  •   Journal:Cell, 1996, 86, 973-983  [MEDLINE:96404450]
  •   [3]  Ptak M.,Hoffmann J.A.,Hetru C.,Sodano P.,Landon C.,
  •   Title:Solution structure of drosomycin, the first inducible antifungal protein from insects.
  •   Journal:Protein Sci., 1997, 6, 1878-1884  [MEDLINE:97445602]
  •   [4]  Hoffmann J.A.,van Dorsselaer A.,Lagueux M.,Moniatte M.,Uttenweiler-Joseph S.,
  •   Title:Differential display of peptides induced during the immune response of Drosophila: a matrix-assisted laser desorption ionization time-of-flight mass spectrometry study.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 1998, 95, 11342-11347  [MEDLINE:98409659]
  •   [5]  Gocayne J.D.,Evans C.A.,Holt R.A.,Celniker S.E.,Adams M.D.,
  •   Title:The genome sequence of Drosophila melanogaster.
  •   Journal:Science, 2000, 287, 2185-2195  [MEDLINE:20196006]
  •   [6]  Champe M.,Yu C.,Brokstein P.,Carlson J.W.,Stapleton M.,
  •   Title:A Drosophila full-length cDNA resource.
  •   Journal:Genome Biol., 2002, 3, 0-0  [MEDLINE:22426066]
  •   [7]  Campbell K.S.,Matthews B.B.,Mungall C.J.,Crosby M.A.,Misra S.,
  •   Title:Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
  •   Journal:Genome Biol., 2002, 3, 0-0  [MEDLINE:22426069]
  •   [8]  Gascan H.,Lelievre E.,Hoffmann J.A.,Tauszig-Delamasure S.,Weber A.N.,
  •   Title:Binding of the Drosophila cytokine Spatzle to Toll is direct and establishes signaling.
  •   Journal:Nat. Immunol., 2003, 4, 794-800  [MEDLINE:22770739]
  •   [9]  Kim K.W.,Jiggins F.M.,
  •   Title:The evolution of antifungal peptides in Drosophila.
  •   Journal:Genetics, 2005, 171, 1847-1859  [PubMed:16157672]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: