Record in detail

lamp_id:L01A000076
Name:GGN1_GLARU
FullName:Gaegurin-1
Source:Glandirana rugosa
Mass:3462.1 Da
Sequence Length:33 aa
Isoelectric Point:10.3
Activity:Antibacterial, Antifungal, Antiparasitic
Sequence
SLFSLIKAGAKFLGKNLLKQGACYAACKASKQC
Function:Has a non-hemolytic activity. Has a broad spectrum of activity against both Gram-positive and Gram-negative bacteria, fungi and protozoa.

Top similar AMPs on LAMP
1. L01A000076 From 1 To 33 E-value: 0.000000000001 Score: 63.9
SLFSLIKAGAKFLGKNLLKQGACYAACKASKQC
2. L01A000288 From 1 To 33 E-value: 0.00000000005 Score: 58.2
SLFSLIKAGAKFLGKNLLKQGAQYAACKVSKEC
3. L12A07228| From 40 To 76 E-value: 0.0000003 Score: 45.8
SIFSLFKAGAKFFGKNLLKEAGKAGAAHLACKATNQC
4. L13A025266 From 1 To 37 E-value: 0.0000006 Score: 44.7
SIFSLFKAGAKFFGKNLLKEAGKAGAAHLACKATNQC
5. L12A07247| From 41 To 76 E-value: 0.000001 Score: 43.5
LFSILKIGAKVIGKNLLKQAGKAGMEYAACKATNQC

Antibacterial Activities
1 Target: Micrococcus luteus MIC: 5 μg/ml (1.44421 μM)
2 Target: Staphylococcus epidermidis MIC: 50 μg/ml (14.4421 μM)
3 Target: Bacillus subtilis MIC: 50 μg/ml (14.4421 μM)
4 Target: Klebsiella pneumoniae MIC: 100 μg/ml (28.8842 μM)
5 Target: Shigella dysentariae MIC: 25 μg/ml (7.22105 μM)
6 Target: Pseudomonas putida MIC: 50 μg/ml (14.4421 μM)
7 Target: Pseudomonas aeruginosa MIC: 50 μg/ml (14.4421 μM)
8 Target: Eshchericia coli MIC: 25 μg/ml (7.22105 μM)
9 Target: Saccharomyces cerevisiae MIC: 200 μg/ml (57.7684 μM)
10 Target: Candida albicans MIC: 200 μg/ml (57.7684 μM)
11 Target: Salmonella typhimurium MIC: 200 μg/ml (57.7684 μM)
12 Target: Proteus mirabilis MIC: 200 μg/ml (57.7684 μM)
13 Target: Serratia marcescens MIC: 200 μg/ml (57.7684 μM)