Record in detail
General Info
- lamp_id:L01A000084
- Name:DEF3_RABIT
- FullName:Corticostatin-3
- Source:Oryctolagus cuniculus
- Mass:3897.7 Da
- Sequence Length:33 aa
- Isoelectric Point:11.9
- Activity:Antibacterial, Antifungal, Antiviral
- Sequence
VVCACRRALCLPRERRAGFCRIRGRIHPLCCRR - Function:This peptide has antibiotic, anti-fungi and antiviral activity. It also inhibits corticotropin (ACTH) stimulated corticosterone production.
Cross-Linking
- Cross-linking
- 1 Database:APD 187
- 2 Database:CAMP CAMPSQ76
- 3 Database:dbAMP dbAMP_11954
- 4 Database:DRAMP DRAMP03804
- 5 Database:SATPdb satpdb17105
- 6 Database:Uniprot P01376
- 7 Database:DEF DEF250
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L03A000279 From 63 To 95 E-value: 0.00000000000007 Score: 67.8
VVCACRRALCLPRERRAGFCRIRGRIHPLCCRR - 2. L03A000278 From 63 To 95 E-value: 0.0000000000005 Score: 65.1
VVCACRRALCLPLERRAGFCRIRGRIHPLCCRR - 3. L01A000084 From 1 To 33 E-value: 0.000000000002 Score: 62.8
VVCACRRALCLPRERRAGFCRIRGRIHPLCCRR - 4. L01A000085 From 1 To 33 E-value: 0.000000000009 Score: 60.5
VVCACRRALCLPLERRAGFCRIRGRIHPLCCRR - 5. L12A09221| From 63 To 94 E-value: 0.0001 Score: 37.4
IICHCRRLLCLSSEHLSGICTIKGVRYPFCCR
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Lehrer R.I.,Delange R.J.,Brown D.M.,Selsted M.E.,
- Title:Primary structures of MCP-1 and MCP-2, natural peptide antibiotics of rabbit lung macrophages.
- Journal:J. Biol. Chem., 1983, 258, 14485-14489 [MEDLINE:84061901]
- [2] Lehrer R.I.,Harwig S.S.L.,Delange R.J.,Brown D.M.,Selsted M.E.,
- Title:Primary structures of six antimicrobial peptides of rabbit peritoneal neutrophils.
- Journal:J. Biol. Chem., 1985, 260, 4579-4584 [MEDLINE:85182561]
- [3] Talmadge K.,Tumolo A.,Valore E.V.,Rayner J.R.,Ganz T.,
- Title:The structure of the rabbit macrophage defensin genes and their organ-specific expression.
- Journal:J. Immunol., 1989, 143, 1358-1365 [MEDLINE:89309825]
- [4] Solomon S.,Zhu Q.,
- Title:Isolation and mode of action of rabbit corticostatic (antiadrenocorticotropin) peptides.
- Journal:Endocrinology, 1992, 130, 1413-1423 [MEDLINE:92164536]
Comments
- Comments
No comments found on LAMP database