Record in detail


General Info

  • lamp_id:L01A000086
  • Name:DEFI_AESCY
  • FullName:Defensin
  • Source:Aeshna cyanea
  • Mass:4179.8 Da
  • Sequence Length:38 aa
  • Isoelectric Point:8.39
  • Activity:Antibacterial
  • Sequence
        GFGCPLDQMQCHRHCQTITGRSGGYCSGPLKLTCTCYR
  • Function:Mediates the inducible antibacterial activity in larvae of A.cyanea.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000086    From 1 To 38 E-value: 1e-17 Score: 79.7
        GFGCPLDQMQCHRHCQTITGRSGGYCSGPLKLTCTCYR
  • 2. L05ADEF518    From 1 To 37 E-value: 0.0000000001 Score: 57
        GFGCPFNQGACHRHCQSI-GRKGGYCSGLFKQTCTCYR
  • 3. L12A01314|    From 14 To 50 E-value: 0.0000000002 Score: 56.2
        GFGCPLNQGACHRHCRSIR-RRGGYCSGIIKQTCTCYR
  • 4. L02A000539    From 1 To 37 E-value: 0.0000000003 Score: 55.8
        GFGCPWNRYQCHSHCRSI-GRLGGYCAGSLRLTCTCYR
  • 5. L05ADEF496    From 1 To 36 E-value: 0.0000000003 Score: 55.8
        GFGCPFDQGACHRHCQSI-GRRGGYCAGFIKQTCTCY

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Bischoff R.,Sauber F.,Reuland M.,Cociancich S.,Bulet P.,
  •   Title:A novel insect defensin mediates the inducible antibacterial activity in larvae of the dragonfly Aeschna cyanea (Paleoptera, Odonata).
  •   Journal:Eur. J. Biochem., 1992, 209, 977-984  [MEDLINE:93049356]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: