Record in detail


General Info

  • lamp_id:L01A000088
  • Name:DIP_DROME
  • FullName:Diptericin
  • Source:Drosophila melanogaster
  • Mass:8902.7 Da
  • Sequence Length:83 aa
  • Isoelectric Point:6.8
  • Activity:Antibacterial
  • Sequence
        DDMTMKPTPPPQYPLNLQGGGGGQSGDGFGFAVQGHQKVWTSDNGRHEIGLNGGYGQHLGGPYGNSEPSWKVGSTYTYRFPNF
  • Function:Required to resist Gram-negative bacterial infections, regulated by Dredd.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000088    From 1 To 83 E-value: 1.96182e-44 Score: 169
        DDMTMKPTPPPQYPLNLQGGGGGQSGDGFGFAVQGHQKVWTSDNGRHEIGLNGGYGQHLGGPYGNSEPSWKVGSTYTYRFPNF
  • 2. L02A001565    From 1 To 83 E-value: 2.00386e-43 Score: 166
        DDMTMKPTPPPQYPLNLQGGGGGGSGDGFGFAVQGHQKVWTSDNGRHEIGLNGGYGQHLGGPYGNSEPSWKVGSTYTYRFPNF
  • 3. L12A01007|    From 1 To 80 E-value: 1.99993e-41 Score: 159
        DDMTMKPTPPPQYPLNLQGGGGGGSGDGFGFAVQGHQKVWTSDNGRHEIGLNGGYGQHLGGPYGNSEPSWKVGSTYTYRF
  • 4. L13A020729    From 1 To 50 E-value: 8e-24 Score: 100
        DDMTMKPTPPPQYPLNLQGGGGGGSGDGFGFAVQGHQKVWTSDNGRHEIG
  • 5. L01A002945    From 7 To 82 E-value: 2e-19 Score: 86.3
        ILPTPAPPNLPQLVGGGGGNRKDGFGVSVDAHQKVWTSDNGRHSIGVTPGYSQHLGGPYGNSRPDYRIGAGYSYNF

Structure

  •   Domains
  •   1  Name:Attacin_C    Interpro Link:IPR005521
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Samakovlis C.,Hultmark D.,Hoffmann D.,Reichhart J.-M.,Wicker C.,
  •   Title:Insect immunity. Characterization of a Drosophila cDNA encoding a novel member of the diptericin family of immune peptides.
  •   Journal:J. Biol. Chem., 1990, 265, 22493-22498  [MEDLINE:91093098]
  •   [2]  Hoffmann D.,Zachary D.,Dimarcq J.-L.,Meister M.,Reichhart J.-M.,
  •   Title:Insect immunity: developmental and inducible activity of the Drosophila diptericin promoter.
  •   Journal:EMBO J., 1992, 11, 1469-1477  [MEDLINE:92224885]
  •   [3]  Wang L.,Clark A.G.,
  •   Title:Molecular population genetics of Drosophila immune system genes.
  •   Journal:Genetics, 1997, 147, 713-724  [MEDLINE:97476321]
  •   [4]  Lemaitre B.,Abrams J.M.,Khush R.S.,Rodriguez A.,Leulier F.,
  •   Title:The Drosophila caspase Dredd is required to resist Gram-negative bacterial infection.
  •   Journal:EMBO Rep., 2000, 1, 353-358  [PubMed:11269502]
  •   [5]  Gocayne J.D.,Evans C.A.,Holt R.A.,Celniker S.E.,Adams M.D.,
  •   Title:The genome sequence of Drosophila melanogaster.
  •   Journal:Science, 2000, 287, 2185-2195  [MEDLINE:20196006]
  •   [6]  Champe M.,Yu C.,Brokstein P.,Carlson J.W.,Stapleton M.,
  •   Title:A Drosophila full-length cDNA resource.
  •   Journal:Genome Biol., 2002, 3, 0-0  [MEDLINE:22426066]
  •   [7]  Campbell K.S.,Matthews B.B.,Mungall C.J.,Crosby M.A.,Misra S.,
  •   Title:Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
  •   Journal:Genome Biol., 2002, 3, 0-0  [MEDLINE:22426069]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: