Record in detail


General Info

  • lamp_id:L01A000094
  • Name:GIP_PIG
  • FullName:Gastric inhibitory polypeptide
  • Source:Sus scrofa
  • Mass:4306.9 Da
  • Sequence Length:36 aa
  • Isoelectric Point:9.96
  • Activity:Antibacterial
  • Sequence
        ISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
  • Function:Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000094    From 1 To 36 E-value: 4e-16 Score: 75.1
        ISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ

Structure

  •   Domains
  •   1  Name:Glucagon_GIP_secretin_VIP    Interpro Link:IPR000532
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  B. rnegateriurn Bmll  MIC:  1.03 μg/ml  (0.239151 μM)  
  •   2  Target:  S. pyogenes  MIC:  16.8 μg/ml  (3.90072 μM)  
  •   3  Target:  E. coli D22  MIC:  16.37 μg/ml  (3.80088 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  McIntosh C.H.S.,Otte S.C.,Kwauk S.,Carlquist M.,Joernvall H.,
  •   Title:Amino acid sequence and heterogeneity of gastric inhibitory polypeptide (GIP).
  •   Journal:FEBS Lett., 1981, 123, 205-210  [MEDLINE:81189070]
  •   [2]  Mutt V.,Joernvall H.,Andersson M.,Boman A.,Agerberth B.,
  •   Title:Isolation of three antibacterial peptides from pig intestine: gastric inhibitory polypeptide (7-42), diazepam-binding inhibitor (32-86) and a novel factor, peptide 3910.
  •   Journal:Eur. J. Biochem., 1993, 216, 623-629  [MEDLINE:93387315]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: