Record in detail
General Info
- lamp_id:L01A000099
- Name:BR2GA_RANGU
- FullName:Brevinin-2GHa
- Source:Rana guentheri
- Mass:3417 Da
- Sequence Length:34 aa
- Isoelectric Point:10.38
- Activity:Antibacterial
- Sequence
GFSSLFKAGAKYLLKSVGKAGAQQLACKAANNCA - Function:Antimicrobial peptide. Active against the Gram-positive bacteria S.aureus FDA209P (MIC=14.9 ug/ml) and B.subtilis ATCC 6633 (MIC>64 ug/ml), but not active against the Gram-negative bacterium E.coli or the fungus C.albicans.
Cross-Linking
- Cross-linking
- 1 Database:APD 582
- 2 Database:CAMP CAMPSQ89
- 3 Database:DBAASP 1588
- 4 Database:dbAMP dbAMP_02698
- 5 Database:DRAMP DRAMP01909
- 6 Database:SATPdb satpdb25757
- 7 Database:Uniprot P84860
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000099 From 1 To 34 E-value: 0.0000000000003 Score: 65.5
GFSSLFKAGAKYLLKSVGKAGAQQLACKAANNCA - 2. L13A017513 From 1 To 37 E-value: 0.000001 Score: 43.9
GIFSLFKAGAKFFGKNLLKEAGKAGAEHLACKAANQC - 3. L12A07243| From 40 To 76 E-value: 0.000001 Score: 43.5
GIFSLFKAGAKFFGKHLLKQAGKAGAEHLACKATNQC - 4. L13A010483 From 1 To 37 E-value: 0.000002 Score: 42.7
GIFSLFKAGAKFFGKHLLKQAGKAGAEHLACKATNQC - 5. L12A07228| From 43 To 76 E-value: 0.000006 Score: 41.2
SLFKAGAKFFGKNLLKEAGKAGAAHLACKATNQC
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: S. aureus FDA209P MIC: 14.9 μg/ml (4.36055 μM)
- 2 Target: B.subtilis ATCC 6633 MIC: 64 μg/ml (18.7299 μM)
- 3 Target: S. aureus MIC: 15.0348 μg/ml (4.4 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Shaw C.,Zhang Y.,Thompson A.,McClean S.,Zhou J.,
- Title:Purification and characterization of novel antimicrobial peptides from the skin secretion of Hylarana guentheri.
- Journal:Peptides, 2006, 27, 3077-3084 [PubMed:16979798]
Comments
- Comments
No comments found on LAMP database