Record in detail
General Info
- lamp_id:L01A000101
- Name:BR2GC_RANGU
- FullName:Brevinin-2GHc
- Source:Rana guentheri
- Mass:3260.8 Da
- Sequence Length:31 aa
- Isoelectric Point:9.6
- Activity:Antibacterial
- Sequence
SIWEGIKNAGKGFLVSILDKVRCKVAGGCNP - Function:Antimicrobial peptide. Active against the Gram-positive bacteria S.aureus FDA209P (MIC=9.8 ug/ml) and B.subtilis ATCC 6633 (MIC>64 ug/ml), and the Gram-negative bacteria E.coli O111 (MIC=19.6 ug/ml) and E.coli ATCC 25922 (MIC=9.8 ug/ml). Not active against the fungus C.albicans.
Cross-Linking
- Cross-linking
- 1 Database:APD 585
- 2 Database:CAMP CAMPSQ91
- 3 Database:DBAASP 1595
- 4 Database:dbAMP dbAMP_11076
- 5 Database:DRAMP DRAMP01911
- 6 Database:SATPdb satpdb21134
- 7 Database:Uniprot A0AEI6
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A07275| From 42 To 72 E-value: 0.0000000000001 Score: 66.6
SIWEGIKNAGKGFLVSILDKVRCKVAGGCNP - 2. L01A000101 From 1 To 31 E-value: 0.0000000000006 Score: 64.7
SIWEGIKNAGKGFLVSILDKVRCKVAGGCNP - 3. L13A018473 From 1 To 30 E-value: 0.000000000002 Score: 62.8
IWEGIKNAGKGFLVSILDKVRCKVAGGCNP - 4. L12A07271| From 42 To 72 E-value: 0.0000000002 Score: 55.8
SIWDIIKDTGKGFLVSILDKVRCKVAGGCPP - 5. L13A018870 From 1 To 31 E-value: 0.0000000005 Score: 54.7
SIWDIIKDTGKGFLVSILDKVRCKVAGGCPP
Activity
- Antibacterial Activities
- 1 Target: S. aureus FDA209P MIC: 9.8 μg/ml (3.0054 μM)
- 2 Target: B. subtilis ATCC 6633 MIC: 64 μg/ml (19.6271 μM)
- 3 Target: E. coli ATCC 25922 MIC: 9.8 μg/ml (3.0054 μM)
- 4 Target: E. coli MIC: 9.7824 μg/ml (3 μM)
- 5 Target: S. aureus MIC: 9.7824 μg/ml (3 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Shaw C.,Zhang Y.,Thompson A.,McClean S.,Zhou J.,
- Title:Purification and characterization of novel antimicrobial peptides from the skin secretion of Hylarana guentheri.
- Journal:Peptides, 2006, 27, 3077-3084 [PubMed:16979798]
Comments
- Comments
No comments found on LAMP database