Record in detail


General Info

  • lamp_id:L01A000107
  • Name:ES1SB_RANSV
  • FullName:Esculentin-1SEb
  • Source:Rana sevosa
  • Mass:4939.9 Da
  • Sequence Length:46 aa
  • Isoelectric Point:10.63
  • Activity:Antibacterial
  • Sequence
        GLFSKFNKKKIKSGLFKIIKTAGKEAGLEALRTGIDVIGCKIKGEC
  • Function:Mast cell degranulating peptide. Causes histamine release from rat peritoneal mast cells in vitro. Has antibacterial activity against the Gram-negative bacterium E.coli K12 and Gram-positive bacterium M.luteus NCT C2665.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000107    From 1 To 46 E-value: 7e-20 Score: 87.4
        GLFSKFNKKKIKSGLFKIIKTAGKEAGLEALRTGIDVIGCKIKGEC
  • 2. L01A000106    From 1 To 46 E-value: 3e-19 Score: 85.5
        GLFSKFNKKKIKSGLIKIIKTAGKEAGLEALRTGIDVIGCKIKGEC
  • 3. L02A001503    From 1 To 46 E-value: 1e-18 Score: 83.6
        GLFSKLNKKKIKSGLIKIIKTAGKEAGLEALRTGIDVIGCKIKGEC
  • 4. L02A001273    From 1 To 46 E-value: 7e-17 Score: 77.8
        GLFPKFNKKKVKTGIFDIIKTVGKEAGMDVLRTGIDVIGCKIKGEC
  • 5. L02A000649    From 1 To 46 E-value: 0.00000000000001 Score: 70.5
        GLFPKINKKKAKTGVFNIIKTVGKEAGMDLIRTGIDTIGCKIKGEC

Structure

  •   Domains
  •   1  Name:Antimicrobial_frog_2    Interpro Link:IPR012521
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Flatt P.R.,O"Kane E.,McClean S.,Richter S.C.,Graham C.,
  •   Title:Histamine-releasing and antimicrobial peptides from the skin secretions of the dusky gopher frog, Rana sevosa.
  •   Journal:Peptides, 2006, 27, 1313-1319  [PubMed:16386333]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: