Record in detail
General Info
- lamp_id:L01A000119
- Name:SPAS_BACIU
- FullName:Lantibiotic subtilin
- Source:Bacillus subtilis
- Mass:3465.1 Da
- Sequence Length:32 aa
- Isoelectric Point:8.21
- Activity:Antibacterial
- Sequence
WKSESLCTPGCVTGALQTCFLQTLTCNCKISK - Function:Lanthionine-containing peptide antibiotic (lantibiotic) active on Gram-positive bacteria. The bactericidal activity of lantibiotics is based on depolarization of energized bacterial cytoplasmic membranes, initiated by the formation of aqueous transmembrane pores.
Cross-Linking
- Cross-linking
- 1 Database:APD 206
- 2 Database:CAMP CAMPSQ1185
- 3 Database:dbAMP dbAMP_12037
- 4 Database:DRAMP DRAMP00048
- 5 Database:SATPdb satpdb21797
- 6 Database:Uniprot P10946
- 7 Database:BAC BAC045
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A09339| From 25 To 56 E-value: 0.00000000000007 Score: 67.8
WKSESLCTPGCVTGALQTCFLQTLTCNCKISK - 2. L01A000119 From 1 To 32 E-value: 0.0000000000003 Score: 65.9
WKSESLCTPGCVTGALQTCFLQTLTCNCKISK - 3. L12A09340| From 25 To 56 E-value: 0.000000000001 Score: 63.5
WKSESVCTPGCVTGLLQTCFLQTITCNCKISK - 4. L12A09341| From 25 To 56 E-value: 0.000000000002 Score: 62.8
WKSESVCTPGCVTGVLQTCFLQTITCNCHISK - 5. L02A001712 From 1 To 32 E-value: 0.000000000004 Score: 62
WKSESVCTPGCVTGLLQTCFLQTITCNCKISK
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Nebelin E.,Kiltz H.H.,Gross E.,
- Title:Subtilin, VI: the structure of subtilin.
- Journal:Hoppe-Seyler"s Z. Physiol. Chem., 1973, 354, 810-812 [MEDLINE:75040028]
- [2] Hansen J.N.,Banerjee S.,
- Title:Structure and expression of a gene encoding the precursor of subtilin, a small protein antibiotic.
- Journal:J. Biol. Chem., 1988, 263, 9508-9514 [MEDLINE:88243844]
- [3] Sahl H.-G.,Benz R.,Schueller F.,
- Title:The peptide antibiotic subtilin acts by formation of voltage-dependent multi-state pores in bacterial and artificial membranes.
- Journal:Eur. J. Biochem., 1989, 182, 181-186 [MEDLINE:89276381]
- [4] Entian K.-D.,Schnell N.,Kaletta C.,Klein C.,
- Title:Analysis of genes involved in biosynthesis of the lantibiotic subtilin.
- Journal:Appl. Environ. Microbiol., 1992, 58, 132-142 [MEDLINE:92171481]
- [5] Hansen J.N.,Chung Y.J.,
- Title:Determination of the sequence of spaE and identification of a promoter in the subtilin (spa) operon in Bacillus subtilis.
- Journal:J. Bacteriol., 1992, 174, 6699-6702 [MEDLINE:93015727]
- [6] Yang J.C.,Lian L.-Y.,Leylands M.L.,Bycroft B.W.,Chan W.C.,
- Title:Sequence-specific resonance assignment and conformational analysis of subtilin by 2D NMR.
- Journal:FEBS Lett., 1992, 300, 56-62 [MEDLINE:92192284]
- [7] Hansen J.N.,Steen M.T.,Chung Y.J.,
- Title:The subtilin gene of Bacillus subtilis ATCC 6633 is encoded in an operon that contains a homolog of the hemolysin B transport protein.
- Journal:J. Bacteriol., 1992, 174, 1417-1422 [MEDLINE:92138640]
- [8] Roberts G.C.K.,Lian L.-Y.,Leyland M.L.,Bycroft B.W.,Chan W.C.,
- Title:A novel post-translational modification of the peptide antibiotic subtilin: isolation and characterization of a natural variant from Bacillus subtilis A.T.C.C. 6633.
- Journal:Biochem. J., 1993, 291, 23-27 [PubMed:8471040]
- [9] Hansen J.N.,Liu W.,
- Title:The antimicrobial effect of a structural variant of subtilin against outgrowing Bacillus cereus T spores and vegetative cells occurs by different mechanisms.
- Journal:Appl. Environ. Microbiol., 1993, 59, 648-651 [MEDLINE:93167833]
- [10] Entian K.-D.,Klein C.,
- Title:Genes involved in self-protection against the lantibiotic subtilin produced by Bacillus subtilis ATCC 6633.
- Journal:Appl. Environ. Microbiol., 1994, 60, 2793-2801 [MEDLINE:94368094]
Comments
- Comments
No comments found on LAMP database