Record in detail


General Info

  • lamp_id:L01A000119
  • Name:SPAS_BACIU
  • FullName:Lantibiotic subtilin
  • Source:Bacillus subtilis
  • Mass:3465.1 Da
  • Sequence Length:32 aa
  • Isoelectric Point:8.21
  • Activity:Antibacterial
  • Sequence
        WKSESLCTPGCVTGALQTCFLQTLTCNCKISK
  • Function:Lanthionine-containing peptide antibiotic (lantibiotic) active on Gram-positive bacteria. The bactericidal activity of lantibiotics is based on depolarization of energized bacterial cytoplasmic membranes, initiated by the formation of aqueous transmembrane pores.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09339|    From 25 To 56 E-value: 0.00000000000007 Score: 67.8
        WKSESLCTPGCVTGALQTCFLQTLTCNCKISK
  • 2. L01A000119    From 1 To 32 E-value: 0.0000000000003 Score: 65.9
        WKSESLCTPGCVTGALQTCFLQTLTCNCKISK
  • 3. L12A09340|    From 25 To 56 E-value: 0.000000000001 Score: 63.5
        WKSESVCTPGCVTGLLQTCFLQTITCNCKISK
  • 4. L12A09341|    From 25 To 56 E-value: 0.000000000002 Score: 62.8
        WKSESVCTPGCVTGVLQTCFLQTITCNCHISK
  • 5. L02A001712    From 1 To 32 E-value: 0.000000000004 Score: 62
        WKSESVCTPGCVTGLLQTCFLQTITCNCKISK

Structure

  •   Domains
  •   1  Name:Lan    Interpro Link:IPR006079
  •   2  Name:Nisin    Interpro Link:IPR000446
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Nebelin E.,Kiltz H.H.,Gross E.,
  •   Title:Subtilin, VI: the structure of subtilin.
  •   Journal:Hoppe-Seyler"s Z. Physiol. Chem., 1973, 354, 810-812  [MEDLINE:75040028]
  •   [2]  Hansen J.N.,Banerjee S.,
  •   Title:Structure and expression of a gene encoding the precursor of subtilin, a small protein antibiotic.
  •   Journal:J. Biol. Chem., 1988, 263, 9508-9514  [MEDLINE:88243844]
  •   [3]  Sahl H.-G.,Benz R.,Schueller F.,
  •   Title:The peptide antibiotic subtilin acts by formation of voltage-dependent multi-state pores in bacterial and artificial membranes.
  •   Journal:Eur. J. Biochem., 1989, 182, 181-186  [MEDLINE:89276381]
  •   [4]  Entian K.-D.,Schnell N.,Kaletta C.,Klein C.,
  •   Title:Analysis of genes involved in biosynthesis of the lantibiotic subtilin.
  •   Journal:Appl. Environ. Microbiol., 1992, 58, 132-142  [MEDLINE:92171481]
  •   [5]  Hansen J.N.,Chung Y.J.,
  •   Title:Determination of the sequence of spaE and identification of a promoter in the subtilin (spa) operon in Bacillus subtilis.
  •   Journal:J. Bacteriol., 1992, 174, 6699-6702  [MEDLINE:93015727]
  •   [6]  Yang J.C.,Lian L.-Y.,Leylands M.L.,Bycroft B.W.,Chan W.C.,
  •   Title:Sequence-specific resonance assignment and conformational analysis of subtilin by 2D NMR.
  •   Journal:FEBS Lett., 1992, 300, 56-62  [MEDLINE:92192284]
  •   [7]  Hansen J.N.,Steen M.T.,Chung Y.J.,
  •   Title:The subtilin gene of Bacillus subtilis ATCC 6633 is encoded in an operon that contains a homolog of the hemolysin B transport protein.
  •   Journal:J. Bacteriol., 1992, 174, 1417-1422  [MEDLINE:92138640]
  •   [8]  Roberts G.C.K.,Lian L.-Y.,Leyland M.L.,Bycroft B.W.,Chan W.C.,
  •   Title:A novel post-translational modification of the peptide antibiotic subtilin: isolation and characterization of a natural variant from Bacillus subtilis A.T.C.C. 6633.
  •   Journal:Biochem. J., 1993, 291, 23-27  [PubMed:8471040]
  •   [9]  Hansen J.N.,Liu W.,
  •   Title:The antimicrobial effect of a structural variant of subtilin against outgrowing Bacillus cereus T spores and vegetative cells occurs by different mechanisms.
  •   Journal:Appl. Environ. Microbiol., 1993, 59, 648-651  [MEDLINE:93167833]
  •   [10]  Entian K.-D.,Klein C.,
  •   Title:Genes involved in self-protection against the lantibiotic subtilin produced by Bacillus subtilis ATCC 6633.
  •   Journal:Appl. Environ. Microbiol., 1994, 60, 2793-2801  [MEDLINE:94368094]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: