Record in detail
General Info
- lamp_id:L01A000123
- Name:MBP1_MAIZE
- FullName:Antimicrobial peptide MBP-1
- Source:Zea mays
- Mass:4130.7 Da
- Sequence Length:33 aa
- Isoelectric Point:11.85
- Activity:Antibacterial, Antifungal
- Sequence
RSGRGECRRQCLRRHEGQPWETQECMRRCRRRG - Function:Inhibitor of both bacterial and fungal growth in vitro.
Cross-Linking
- Cross-linking
- 1 Database:APD 184
- 2 Database:CAMP CAMPSQ111
- 3 Database:DBAASP 4350
- 4 Database:dbAMP dbAMP_10771
- 5 Database:DRAMP DRAMP00998
- 6 Database:SATPdb satpdb14791
- 7 Database:Uniprot P28794
- 8 Database:AMD MBP1_MAIZE
- 9 Database:PHY PHYT00258
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A02468| From 11 To 43 E-value: 0.0000000000004 Score: 65.1
RSGRGECRRQCLRRHEGQPWETQECMRRCRRRG - 2. L01A000123 From 1 To 33 E-value: 0.000000000001 Score: 63.9
RSGRGECRRQCLRRHEGQPWETQECMRRCRRRG - 3. L01A001515 From 1 To 33 E-value: 0.000000000001 Score: 63.5
RSGRGECRRQCLRRHEGQPWETQECMRRCRRRG - 4. L13A012134 From 1 To 31 E-value: 0.0000002 Score: 46.2
SGRGSCRSQCMRRHEDEPWRVQECVSQCRRR - 5. L02A001760 From 2 To 32 E-value: 0.0000002 Score: 46.2
SGRGSCRSQCMRRHEDEPWRVQECVSQCRRR
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Marshak D.R.,Rao A.G.,Rood T.,Duvick J.P.,
- Title:Purification and characterization of a novel antimicrobial peptide from maize (Zea mays L.) kernels.
- Journal:J. Biol. Chem., 1992, 267, 18814-18820 [MEDLINE:92406801]
Comments
- Comments
No comments found on LAMP database