Record in detail


General Info

  • lamp_id:L01A000129
  • Name:CXCL7_HUMAN
  • FullName:Platelet basic protein
  • Source:Homo sapiens
  • Mass:7225.5 Da
  • Sequence Length:66 aa
  • Isoelectric Point:9.52
  • Activity:Antibacterial, Antifungal
  • Sequence
        AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGD
  • Function:LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001119    From 24 To 89 E-value: 1e-34 Score: 136
        AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGD
  • 2. L01A001118    From 17 To 82 E-value: 2e-34 Score: 135
        AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGD
  • 3. L01A001121    From 17 To 82 E-value: 2e-34 Score: 135
        AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGD
  • 4. L01A001130    From 16 To 81 E-value: 2e-34 Score: 135
        AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGD
  • 5. L01A001125    From 16 To 81 E-value: 2e-34 Score: 135
        AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGD

Structure

  •   Domains
  •   1  Name:Chemokine_CXC    Interpro Link:IPR001089
  •   2  Name:Chemokine_CXC_CS    Interpro Link:IPR018048
  •   3  Name:Chemokine_CXCL8/IL8    Interpro Link:IPR002473
  •   4  Name:Chemokine_IL8-like_dom    Interpro Link:IPR001811
  •   Structures
  •   1
    PDB:1F9P
    Method:X-ray
    Chains:A=44-128
  •   2
    PDB:1NAP
    Method:X-ray
    Chains:A/B/C/D=59-128
  •   3
    PDB:1TVX
    Method:X-ray
    Chains:A/B/C/D=54-128

Activity

  •   Antibacterial Activities
  •   1  Target:  B. subtilis ATCC 6633  MIC:  2.89 μg/ml  (0.399972 μM)  
  •   2  Target:  E. coli ML35  MIC:  24.57 μg/ml  (3.40046 μM)  
  •   3  Target:  S. aureus 42D  MIC:  49.13 μg/ml  (6.79953 μM)  
  •   4  Target:  C. neoformans  MIC:  13.73 μg/ml  (1.90021 μM)  
  •   5  Target:  C.glabrata  MIC:  216.76 μg/ml  (29.9993 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Morgan F.J.,Chesterman C.N.,Pepper D.S.,Begg G.S.,
  •   Title:Complete covalent structure of human beta-thromboglobulin.
  •   Journal:Biochemistry, 1978, 17, 1739-1744  [MEDLINE:78187279]
  •   [2]  Walz D.A.,Miller J.W.,Castor C.W.,
  •   Title:Structural and biological characteristics of connective tissue activating peptide (CTAP-III), a major human platelet-derived growth factor.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 1983, 80, 765-769  [MEDLINE:83144010]
  •   [3]  Henschen A.,Lange E.,Holt A.M.,Harris M.E.,Holt J.C.,
  •   Title:Characterization of human platelet basic protein, a precursor form of low-affinity platelet factor 4 and beta-thromboglobulin.
  •   Journal:Biochemistry, 1986, 25, 1988-1996  [MEDLINE:86216117]
  •   [4]  Baggiolini M.,Walz A.,
  •   Title:A novel cleavage product of beta-thromboglobulin formed in cultures of stimulated mononuclear cells activates human neutrophils.
  •   Journal:Biochem. Biophys. Res. Commun., 1989, 159, 969-975  [MEDLINE:89193761]
  •   [5]  Clemetson K.J.,Kieffer N.,Walz A.,Wicki A.N.,Wenger R.H.,
  •   Title:Cloning of cDNA coding for connective tissue activating peptide III from a human platelet-derived lambda gt11 expression library.
  •   Journal:Blood, 1989, 73, 1498-1503  [MEDLINE:89229374]
  •   [6]  Smith E.M.,Hossler P.A.,Ragsdale C.G.,Walz D.A.,Castor C.W.,
  •   Title:Connective tissue activation. XXXIII. Biologically active cleavage products of CTAP-III from human platelets.
  •   Journal:Biochem. Biophys. Res. Commun., 1989, 163, 1071-1078  [MEDLINE:89391960]
  •   [7]  Baggiolini M.,Walz A.,
  •   Title:Generation of the neutrophil-activating peptide NAP-2 from platelet basic protein or connective tissue-activating peptide III through monocyte proteases.
  •   Journal:J. Exp. Med., 1990, 171, 449-454  [MEDLINE:90155110]
  •   [8]  Poncz M.,Koutsis B.,Gonder D.,Majumdar S.,
  •   Title:Characterization of the human beta-thromboglobulin gene. Comparison with the gene for platelet factor 4.
  •   Journal:J. Biol. Chem., 1991, 266, 5785-5789  [MEDLINE:91170256]
  •   [9]  Scott G.J.,Baggiolini M.,Walz A.,Mose B.,Clark-Lewis I.,
  •   Title:Chemical synthesis, purification, and characterization of two inflammatory proteins, neutrophil activating peptide 1 (interleukin-8) and neutrophil activating peptide.
  •   Journal:Biochemistry, 1991, 30, 3128-3135  [MEDLINE:91175767]
  •   [10]  Lam C.,Schwer C.,Huber R.,Machius M.,Kungl A.J.,
  •   Title:Purification, crystallization and preliminary X-ray diffraction analysis of recombinant human neutrophil-activating peptide 2 (rhNAP-2).
  •   Journal:FEBS Lett., 1994, 347, 300-303  [MEDLINE:94307404]
  •   [11]  Flad H.D.,Gerdes J.,Kubbutat M.H.,Petersen F.,Ehlert J.E.,
  •   Title:Limited and defined truncation at the C-terminus enhances receptor binding and degranulation activity of the neutrophil-activating peptide 2 (NAP-2). Comparison of native and recombinant NAP-2 variants.
  •   Journal:J. Biol. Chem., 1995, 270, 6338-6344  [MEDLINE:95197674]
  •   [12]  Edwards B.F.P.,Johnson P.H.,Lazar J.B.,Wu J.Y.,Malkowski M.G.,
  •   Title:The crystal structure of recombinant human neutrophil-activating peptide-2 (M6L) at 1.9-A resolution.
  •   Journal:J. Biol. Chem., 1995, 270, 7077-7087  [MEDLINE:95221354]
  •   [13]  Walz A.,de Gaetano G.,Piccoli A.,Evangelista V.,Piccardoni P.,
  •   Title:Thrombin-activated human platelets release two NAP-2 variants that stimulate polymorphonuclear leukocytes.
  •   Journal:Thromb. Haemost., 1996, 76, 780-785  [MEDLINE:97108140]
  •   [14]  Brandt E.,Flad H.-D.,Gerdes J.,Ehlert J.E.,
  •   Title:Novel C-terminally truncated isoforms of the CXC chemokine beta-thromboglobulin and their impact on neutrophil functions.
  •   Journal:J. Immunol., 1998, 161, 4975-4982  [PubMed:9794434]
  •   [15]  Fang G.,van Veelen P.A.,Meeldijk J.,Zaat S.A.,Krijgsveld J.,
  •   Title:Thrombocidins, microbicidal proteins from human blood platelets, are C-terminal deletion products of CXC chemokines.
  •   Journal:J. Biol. Chem., 2000, 275, 20374-20381  [MEDLINE:20347117]
  •   [16]  Feldman M.,Sachis B.S.,Kowalska M.A.,Thornton M.A.,Zhang C.,
  •   Title:Localization of distal regulatory domains in the megakaryocyte-specific platelet basic protein/platelet factor 4 gene locus.
  •   Journal:Blood, 2001, 98, 610-617  [MEDLINE:21361158]
  •   [17]  Staes A.,Van Damme J.,Martens L.,Goethals M.,Gevaert K.,
  •   Title:Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
  •   Journal:Nat. Biotechnol., 2003, 21, 566-569  [MEDLINE:22608298]
  •   [18]  Sugiyama T.,Otsuki T.,Nishikawa T.,Suzuki Y.,Ota T.,
  •   Title:Complete sequencing and characterization of 21,243 full-length human cDNAs.
  •   Journal:Nat. Genet., 2004, 36, 40-45  [PubMed:14702039]
  •   [19]  Henzel W.J.,Zhang Z.,
  •   Title:Signal peptide prediction based on analysis of experimentally verified cleavage sites.
  •   Journal:Protein Sci., 2004, 13, 2819-2824  [PubMed:15340161]
  •   [20]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]
  •   [21]  Pepin K.H.,Fulton L.A.,Fulton R.S.,Graves T.A.,Hillier L.W.,
  •   Title:Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
  •   Journal:Nature, 2005, 434, 724-731  [PubMed:15815621]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: