Record in detail


General Info

  • lamp_id:L01A000140
  • Name:SRX1D_SARPE
  • FullName:Sarcotoxin-1D
  • Source:Sarcophaga peregrina
  • Mass:4348.9 Da
  • Sequence Length:40 aa
  • Isoelectric Point:11.48
  • Activity:Antibacterial
  • Sequence
        GWIRDFGKRIERVGQHTRDATIQTIAVAQQAANVAATLKG
  • Function:Sarcotoxins, which are potent bactericidal proteins, are produced in response to injury. They are cytotoxic to both Gram-positive and Gram-negative bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000140    From 1 To 40 E-value: 7e-18 Score: 80.9
        GWIRDFGKRIERVGQHTRDATIQTIAVAQQAANVAATLKG
  • 2. L11A011570    From 1 To 40 E-value: 0.000000000000009 Score: 70.5
        GWLKKLGKKIERVGQHTRDATIQTIGVAQQAVNVAATLKG
  • 3. L12A08773|    From 24 To 63 E-value: 0.0000000000002 Score: 66.2
        GWLKKLGKRLERVGQHTRDATIQVVGIAQQAANVAATARG
  • 4. L12A08768|    From 24 To 63 E-value: 0.0000000000002 Score: 66.2
        GWLKKLGKRLERVGQHTRDATIQVVGIAQQAANVAATARG
  • 5. L12A08719|    From 24 To 63 E-value: 0.0000000000003 Score: 65.5
        GWLRKLGKKIERIGQHTRDASIQVLGIAQQAANVAATARG

Structure

  •   Domains
  •   1  Name:Cecropin    Interpro Link:IPR000875
  •   2  Name:Cecropin_diptera    Interpro Link:IPR020400
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Natori S.,Matsuyama K.,
  •   Title:Purification of three antibacterial proteins from the culture medium of NIH-Sape-4, an embryonic cell line of Sarcophaga peregrina.
  •   Journal:J. Biol. Chem., 1988, 263, 17112-17116  [MEDLINE:89034215]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: