Record in detail
General Info
- lamp_id:L01A000142
- Name:DEFB7_BOVIN
- FullName:Beta-defensin 7
- Source:Bos taurus
- Mass:4572.5 Da
- Sequence Length:40 aa
- Isoelectric Point:11.71
- Activity:Antibacterial
- Sequence
QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLGPRIKCCR - Function:Has bactericidal activity. Active against E.coli ML35 and S.aureus 502A.
Cross-Linking
- Cross-linking
- 1 Database:APD 42
- 2 Database:CAMP CAMPSQ130
- 3 Database:dbAMP dbAMP_10095
- 4 Database:DRAMP DRAMP02864
- 5 Database:SATPdb satpdb24373
- 6 Database:Uniprot P46165
- 7 Database:AMD BD07_BOVIN
- 8 Database:DEF DEF76
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A09076| From 23 To 62 E-value: 2e-18 Score: 82.4
QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLGPRIKCCR - 2. L12A02361| From 3 To 42 E-value: 1e-17 Score: 80.1
QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLGPRIKCCR - 3. L12A09075| From 23 To 62 E-value: 2e-17 Score: 79.7
QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLGPQIKCCR - 4. L01A000142 From 1 To 40 E-value: 2e-17 Score: 79.7
QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLGPRIKCCR - 5. L03A000068 From 16 To 55 E-value: 2e-17 Score: 79.3
QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLAPQIKCCR
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Novotny M.J.,McGuire P.A.,Morris W.L.,Tang Y.-Q.,Selsted M.E.,
- Title:Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils.
- Journal:J. Biol. Chem., 1993, 268, 6641-6648 [MEDLINE:93203264]
Comments
- Comments
No comments found on LAMP database