Record in detail
General Info
- lamp_id:L01A000143
- Name:DEF2_CAVPO
- FullName:Neutrophil cationic peptide 2
- Source:Cavia porcellus
- Mass:3838.5 Da
- Sequence Length:31 aa
- Isoelectric Point:9.62
- Activity:Antibacterial, Antifungal, Antiviral
- Sequence
RRCICTTRTCRFPYRRLGTCLFQNRVYTFCC - Function:Has antibiotic, anti-fungi and antiviral activity.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ131
- 2 Database:dbAMP dbAMP_10657
- 3 Database:DRAMP DRAMP02985
- 4 Database:SATPdb satpdb24502
- 5 Database:Uniprot P49112
- 6 Database:DEF DEF458
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A09267| From 63 To 93 E-value: 0.0000000000002 Score: 66.6
RRCICTTRTCRFPYRRLGTCLFQNRVYTFCC - 2. L12A09265| From 63 To 93 E-value: 0.0000000000003 Score: 65.9
RRCICTTRTCRFPYRRLGTCIFQNRVYTFCC - 3. L12A09266| From 63 To 93 E-value: 0.0000000000003 Score: 65.5
RRCICTTRTCRFPYRRLGTCIFQNRVYTFCC - 4. L01A000143 From 1 To 31 E-value: 0.000000000005 Score: 61.6
RRCICTTRTCRFPYRRLGTCLFQNRVYTFCC - 5. L01A003255 From 1 To 31 E-value: 0.000000000008 Score: 60.8
RRCICTTRTCRFPYRRLGTCIFQNRVYTFCC
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Yamashita T.,Iwabuchi K.,Someya A.,Nagaoka I.,
- Title:Characterization of cDNA clones encoding guinea pig neutrophil cationic peptides.
- Journal:FEBS Lett., 1991, 280, 287-291 [MEDLINE:91192152]
- [2] Yamashita T.,Iwabuchi K.,Someya A.,Nagaoka I.,
- Title:Structure of the guinea pig neutrophil cationic peptide gene.
- Journal:FEBS Lett., 1992, 303, 31-35 [MEDLINE:92275076]
- [3] Yamashita T.,Nonoguchi A.,Nagaoka I.,
- Title:Cloning and characterization of the guinea pig neutrophil cationic peptide-1 and -2 genes.
- Journal:DNA Seq., 1993, 4, 123-128 [MEDLINE:94227245]
Comments
- Comments
No comments found on LAMP database