Record in detail


General Info

  • lamp_id:L01A000147
  • Name:TAP_BOVIN
  • FullName:Tracheal antimicrobial peptide
  • Source:Bos taurus
  • Mass:4091 Da
  • Sequence Length:38 aa
  • Isoelectric Point:10.62
  • Activity:Antibacterial, Antifungal
  • Sequence
        NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK
  • Function:Has antibacterial activity in vitro against Escherichia coli, Staphylococcus aureus, Klebsiella pneumonia, and Pseudomonas aeruginosa. In addition, the peptide is active against Candida albicans, indicating a broad spectrum of activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001447    From 27 To 64 E-value: 6e-17 Score: 77.8
        NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK
  • 2. L01A000147    From 1 To 38 E-value: 5e-16 Score: 74.7
        NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK
  • 3. L01A000349    From 1 To 38 E-value: 0.000000000000001 Score: 73.6
        NPVSCVRNKGICVPIRCPGNMKQIGTCVGRAVKCCRKK
  • 4. L01A000351    From 1 To 36 E-value: 0.000000000000005 Score: 71.6
        NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCR
  • 5. L12A09081|    From 27 To 64 E-value: 0.000000000000008 Score: 70.9
        NPLSCGRNKGICVPIRCPGKMKQIGTCVGRAVKCCRKK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E. coli D31  MIC:  12 μg/ml  (2.93327 μM)  
  •   2  Target:  K. pneumoniae 13883  MIC:  12 μg/ml  (2.93327 μM)  
  •   3  Target:  Staphylococcus aureus 25923  MIC:  25 μg/ml  (6.11098 μM)  
  •   4  Target:  Pseudomonas aeruginosa 27853  MIC:  25 μg/ml  (6.11098 μM)  
  •   5  Target:  Candida ablicans  MIC:  6 μg/ml  (1.46663 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Maloy W.L.,Brasseur M.,Eck H.,Zasloff M.,Diamond G.,
  •   Title:Tracheal antimicrobial peptide, a cysteine-rich peptide from mammalian tracheal mucosa: peptide isolation and cloning of a cDNA.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 1991, 88, 3952-3956  [MEDLINE:91219490]
  •   [2]  Bevins C.L.,Jones D.E.,Diamond G.,
  •   Title:Airway epithelial cells are the site of expression of a mammalian antimicrobial peptide gene.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 1993, 90, 4596-4600  [MEDLINE:93281626]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: