Record in detail
General Info
- lamp_id:L01A000160
- Name:moricin-like peptide B
- FullName:moricin-like peptide B
- Source:Galleria mellonella (greater wax moth)
- Mass:4633.6 Da
- Sequence Length:43 aa
- Isoelectric Point:11.69
- Activity:Antibacterial, Antifungal
- Sequence
GKIPVKAIKKGGQIIGKALRGINIASTAHDIISQFKPKKKKNH - Function:
Cross-Linking
- Cross-linking
- 1 Database:APD 835
- 2 Database:CAMP CAMPSQ147
- 3 Database:DBAASP 2149
- 4 Database:dbAMP dbAMP_03211
- 5 Database:DRAMP DRAMP03514
- 6 Database:SATPdb satpdb10902
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000160 From 1 To 43 E-value: 2e-18 Score: 82.8
GKIPVKAIKKGGQIIGKALRGINIASTAHDIISQFKPKKKKNH - 2. L01A003202 From 1 To 42 E-value: 0.000000000007 Score: 61.2
GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH - 3. L01A003197 From 1 To 41 E-value: 0.000000000007 Score: 60.8
GKIPVKAIKKAGAAIGKGLRAINIASTAHDVYSFFKPKHKK - 4. L12A07895| From 25 To 64 E-value: 0.00000000003 Score: 58.9
GKIPVGAIKKAGRAIGKGLRAINIASTAHDVYTFFKPKKR - 5. L12A07894| From 25 To 64 E-value: 0.00000000009 Score: 57.4
GKIPIGAIKKAGKAIGKGLRAVNIASTAHDVYTFFKPKKR
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: E. coli MIC: 463.36 μg/ml (100 μM)
- 2 Target: Micrococcus luteus MIC: 463.36 μg/ml (100 μM)
- 3 Target: Fusarium graminearum spores MIC: 46.34 μg/ml (10.0009 μM)
- 4 Target: Fusarium oxysporum spores MIC: 463.36 μg/ml (100 μM)
- 5 Target: Leptosphaeria maculans spores MIC: 463.36 μg/ml (100 μM)
- 6 Target: Fusarium graminearum mycelia MIC: 1297.41 μg/ml (280 μM)
- 7 Target: Fusarium oxysporum mycelia MIC: 1297.41 μg/ml (280 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database