Record in detail
General Info
- lamp_id:L01A000161
- Name:moricin-like peptide C1
- FullName:moricin-like peptide C1
- Source:Galleria mellonella (greater wax moth)
- Mass:3933.7 Da
- Sequence Length:38 aa
- Isoelectric Point:11.21
- Activity:Antibacterial, Antifungal
- Sequence
KVPIGAIKKGGKIIKKGLGVIGAAGTAHEVYSHVKNRH - Function:
Cross-Linking
- Cross-linking
- 1 Database:APD 836
- 2 Database:CAMP CAMPSQ148
- 3 Database:DBAASP 2150
- 4 Database:dbAMP dbAMP_05448
- 5 Database:DRAMP DRAMP03515
- 6 Database:SATPdb satpdb25284
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000161 From 1 To 38 E-value: 0.000000000000002 Score: 72.4
KVPIGAIKKGGKIIKKGLGVIGAAGTAHEVYSHVKNRH - 2. L01A000163 From 1 To 38 E-value: 0.000000000000009 Score: 70.9
KVPIGAIKKGGKIIKKGLGVIGAAGTAHEVYSHVKNRQ - 3. L01A000164 From 1 To 38 E-value: 0.0000000000001 Score: 67
KVPVGAIKKGGKAIKTGLGVVGAAGTAHEVYSHIRNRH - 4. L12A09019| From 26 To 63 E-value: 0.000000000006 Score: 61.2
KVNVNALKKGGRVIKKGLGVIGAAGTAHEVYNHVRNRN - 5. L11A010759 From 3 To 40 E-value: 0.00000000001 Score: 60.5
KVNVNALRKGGRVIRKGLGVIGAAGTAHEVYNHVRNRN
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: E. coli MIC: 39.34 μg/ml (10.0008 μM)
- 2 Target: Micrococcus luteus MIC: 393.37 μg/ml (100 μM)
- 3 Target: Fusarium graminearum spores MIC: 3.93 μg/ml (0.999059 μM)
- 4 Target: Fusarium oxysporum spores MIC: 39.34 μg/ml (10.0008 μM)
- 5 Target: Ascochyta rabiei spores MIC: 393.37 μg/ml (100 μM)
- 6 Target: Leptosphaeria maculans spores MIC: 23.6 μg/ml (5.99944 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database