Record in detail


General Info

  • lamp_id:L01A000162
  • Name:moricin-like peptide C2
  • FullName:moricin-like peptide C2
  • Source:Galleria mellonella (greater wax moth)
  • Mass:3979.7 Da
  • Sequence Length:38 aa
  • Isoelectric Point:11.44
  • Activity:Antibacterial, Antifungal
  • Sequence
        KVPIGAIKKGGKIIKKGLGVLGAAGTAHEVYNHVRNRQ
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000162    From 1 To 38 E-value: 6e-16 Score: 74.3
        KVPIGAIKKGGKIIKKGLGVLGAAGTAHEVYNHVRNRQ
  • 2. L01A000164    From 1 To 38 E-value: 0.0000000000006 Score: 64.7
        KVPVGAIKKGGKAIKTGLGVVGAAGTAHEVYSHIRNRH
  • 3. L12A09019|    From 26 To 63 E-value: 0.000000000002 Score: 63.2
        KVNVNALKKGGRVIKKGLGVIGAAGTAHEVYNHVRNRN
  • 4. L11A010760    From 3 To 40 E-value: 0.000000000004 Score: 62
        KVNVNALKKGGHVIKKGLGVIGAAGTAHEVYNHVRNRN
  • 5. L11A010759    From 3 To 40 E-value: 0.000000000005 Score: 61.6
        KVNVNALRKGGRVIRKGLGVIGAAGTAHEVYNHVRNRN

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E. coli  MIC:  39.8 μg/ml  (10.0008 μM)  
  •   2  Target:  Micrococcus luteus  MIC:  397.97 μg/ml  (100 μM)  
  •   3  Target:  Fusarium graminearum spores  MIC:  3.98 μg/ml  (1.00008 μM)  
  •   4  Target:  Fusarium oxysporum spores  MIC:  39.8 μg/ml  (10.0008 μM)  
  •   5  Target:  Ascochyta rabiei spores  MIC:  397.97 μg/ml  (100 μM)  
  •   6  Target:  Leptosphaeria maculans spores  MIC:  31.84 μg/ml  (8.0006 μM)  
  •   7  Target:  Fusarium graminearum mycelia  MIC:  31.84 μg/ml  (8.0006 μM)  
  •   8  Target:  Fusarium oxysporum mycelia  MIC:  31.84 μg/ml  (8.0006 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: