Record in detail


General Info

  • lamp_id:L01A000163
  • Name:moricin-like peptide C3
  • FullName:moricin-like peptide C3
  • Source:Galleria mellonella (greater wax moth)
  • Mass:3924.7 Da
  • Sequence Length:38 aa
  • Isoelectric Point:11.21
  • Activity:Antibacterial, Antifungal
  • Sequence
        KVPIGAIKKGGKIIKKGLGVIGAAGTAHEVYSHVKNRQ
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000163    From 1 To 38 E-value: 0.000000000000002 Score: 72.8
        KVPIGAIKKGGKIIKKGLGVIGAAGTAHEVYSHVKNRQ
  • 2. L01A000161    From 1 To 38 E-value: 0.000000000000009 Score: 70.9
        KVPIGAIKKGGKIIKKGLGVIGAAGTAHEVYSHVKNRH
  • 3. L01A000164    From 1 To 38 E-value: 0.0000000000005 Score: 65.1
        KVPVGAIKKGGKAIKTGLGVVGAAGTAHEVYSHIRNRH
  • 4. L12A09019|    From 26 To 63 E-value: 0.000000000004 Score: 61.6
        KVNVNALKKGGRVIKKGLGVIGAAGTAHEVYNHVRNRN
  • 5. L11A010759    From 3 To 40 E-value: 0.000000000009 Score: 60.5
        KVNVNALRKGGRVIRKGLGVIGAAGTAHEVYNHVRNRN

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E. coli  MIC:  392.47 μg/ml  (100 μM)  
  •   2  Target:  Micrococcus luteus  MIC:  392.47 μg/ml  (100 μM)  
  •   3  Target:  Fusarium graminearum spores  MIC:  39.25 μg/ml  (10.0008 μM)  
  •   4  Target:  Fusarium oxysporum spores  MIC:  392.47 μg/ml  (100 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: