Record in detail
General Info
- lamp_id:L01A000163
- Name:moricin-like peptide C3
- FullName:moricin-like peptide C3
- Source:Galleria mellonella (greater wax moth)
- Mass:3924.7 Da
- Sequence Length:38 aa
- Isoelectric Point:11.21
- Activity:Antibacterial, Antifungal
- Sequence
KVPIGAIKKGGKIIKKGLGVIGAAGTAHEVYSHVKNRQ - Function:
Cross-Linking
- Cross-linking
- 1 Database:APD 838
- 2 Database:CAMP CAMPSQ150
- 3 Database:DBAASP 2152
- 4 Database:dbAMP dbAMP_05449
- 5 Database:DRAMP DRAMP03517
- 6 Database:SATPdb satpdb24170
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000163 From 1 To 38 E-value: 0.000000000000002 Score: 72.8
KVPIGAIKKGGKIIKKGLGVIGAAGTAHEVYSHVKNRQ - 2. L01A000161 From 1 To 38 E-value: 0.000000000000009 Score: 70.9
KVPIGAIKKGGKIIKKGLGVIGAAGTAHEVYSHVKNRH - 3. L01A000164 From 1 To 38 E-value: 0.0000000000005 Score: 65.1
KVPVGAIKKGGKAIKTGLGVVGAAGTAHEVYSHIRNRH - 4. L12A09019| From 26 To 63 E-value: 0.000000000004 Score: 61.6
KVNVNALKKGGRVIKKGLGVIGAAGTAHEVYNHVRNRN - 5. L11A010759 From 3 To 40 E-value: 0.000000000009 Score: 60.5
KVNVNALRKGGRVIRKGLGVIGAAGTAHEVYNHVRNRN
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: E. coli MIC: 392.47 μg/ml (100 μM)
- 2 Target: Micrococcus luteus MIC: 392.47 μg/ml (100 μM)
- 3 Target: Fusarium graminearum spores MIC: 39.25 μg/ml (10.0008 μM)
- 4 Target: Fusarium oxysporum spores MIC: 392.47 μg/ml (100 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database