Record in detail


General Info

  • lamp_id:L01A000174
  • Name:Anionic antimicrobial peptide 2
  • FullName:Anionic antimicrobial peptide 2
  • Source:Galleria mellonella (greater wax moth)
  • Mass:6979.6 Da
  • Sequence Length:60 aa
  • Isoelectric Point:4.5
  • Activity:Antibacterial, Antifungal
  • Sequence
        ETESTPDYLKNIQQQLEEYTKNFNTQVQNAFDSDKIKSEVNNFIESLGKILNTEKKEAPK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:APD  754
  •   2  Database:CAMP  CAMPSQ160
  •   3  Database:DBAASP  1237
  •   4  Database:dbAMP  dbAMP_01554
  •   5  Database:DRAMP  DRAMP03523
  •   6  Database:Uniprot  P85216

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000174    From 1 To 60 E-value: 2e-29 Score: 119
        ETESTPDYLKNIQQQLEEYTKNFNTQVQNAFDSDKIKSEVNNFIESLGKILNTEKKEAPK
  • 2. L13A013420    From 1 To 50 E-value: 8e-24 Score: 100
        ETESTPDYLKNIQQQLEEYTKNFNTQVQNAFDSDKIKSEVNNFIESLGKI
  • 3. L12A11447|    From 1 To 41 E-value: 4e-18 Score: 82
        TKNFNTQVQNAFDSDKIKSEVNNFIESLGKILNTEKKEAPK
  • 4. L11A006488    From 3 To 24 E-value: 3.7 Score: 21.9
        RIVQRIKDFLRGIGKFLHSAKK
  • 5. L13A027380    From 7 To 45 E-value: 6.1 Score: 21.6
        KGFAKKLWNSKLARKIRTKGLKYVKNFAKDMLSEGEEAP

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  M. luteus  MIC:  302.22 μg/ml  (43.3005 μM)  
  •   2  Target:  P. pastoris  MIC:  302.22 μg/ml  (43.3005 μM)  
  •   3  Target:  P. stipitis  MIC:  302.22 μg/ml  (43.3005 μM)  
  •   4  Target:  L. monocytogenes  MIC:  604.43 μg/ml  (86.5995 μM)  
  •   5  Target:  S.lutea  MIC:  604.43 μg/ml  (86.5995 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: