Record in detail


General Info

  • lamp_id:L01A000175
  • Name:Cecropin-D-like peptide
  • FullName:Cecropin-D-like peptide
  • Source:Galleria mellonella (greater wax moth)
  • Mass:4255.8 Da
  • Sequence Length:39 aa
  • Isoelectric Point:6.67
  • Activity:Antibacterial, Antifungal
  • Sequence
        ENFFKEIERAGQRIRDAIISAAPAVETLAQAQKIIKGGD
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000175    From 1 To 39 E-value: 7e-17 Score: 77.8
        ENFFKEIERAGQRIRDAIISAAPAVETLAQAQKIIKGGD
  • 2. L11A010398    From 1 To 39 E-value: 0.000000000000003 Score: 72.4
        ENFFKRIRRAGKRIRDAIISAAPAVETLAQAQKIIKGGD
  • 3. L11A010399    From 1 To 39 E-value: 0.00000000000004 Score: 68.6
        RNFFKRIRRAGKRIRKAIISAAPAVETLAQAQKIIKGGD
  • 4. L11A009761    From 1 To 39 E-value: 0.00000000000008 Score: 67.8
        ENFFKEKERKGQRIRDAIISRRPRVETLAQAQKIIKGGD
  • 5. L12A07817|    From 26 To 63 E-value: 0.0000000002 Score: 56.2
        NPFKELEKAGQRVRDAIISAAPAVEVVGQASSILKGKN

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  M. luteus L. monocytogenes S. lutea E. coli D31  MIC:  6.9 μg/ml  (1.62132 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: