Record in detail


General Info

  • lamp_id:L01A000178
  • Name:LEB1_GALME
  • FullName:Lebocin-like anionic peptide 1
  • Source:Galleria mellonella
  • Mass:4819.3 Da
  • Sequence Length:42 aa
  • Isoelectric Point:4.3
  • Activity:Antibacterial, Antifungal
  • Sequence
        EADEPLWLYKGDNIERAPTTADHPILPSIIDDVKLDPNRRYA
  • Function:Antimicrobial protein. Has antibacterial activity against the Gram-positive bacteria M.luteus (MIC=22.7 uM) and L.monocytogenes (MIC=90.9 uM). Lacks antibacterial activity against the Gram-positive bacteria B.circulans, S.aureus, and S.lutea, and the Gram-negative bacteria E.coli D31, E.coli ATCC 25922, and S.typhimurium. Has antifungal activity against A.niger (MIC=90.9 uM) and T.harzianum (MIC=90.9 uM), but lacks antifungal activity against S.cerevisiae, P.pastoris, Z.marxianus, C.albicans, C.fructus, and F.oxysporum.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000178    From 1 To 42 E-value: 1e-19 Score: 87
        EADEPLWLYKGDNIERAPTTADHPILPSIIDDVKLDPNRRYA
  • 2. L11A004128    From 3 To 43 E-value: 0.00000000000001 Score: 70.5
        GNEPLWLYQGDNIPKAPSTAEHPFLPSIIDDVKFNPDRRYA
  • 3. L11A004127    From 3 To 43 E-value: 0.00000000000001 Score: 70.1
        GNEPLWLYQGDNIPKAPSTAEHPFLPSIIDDVKFNPDRRYA

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  M. luteus  MIC:  109.4 μg/ml  (22.7004 μM)  
  •   2  Target:  L.monocytogenes  MIC:  438.07 μg/ml  (90.8991 μM)  
  •   3  Target:  A.niger  MIC:  438.07 μg/ml  (90.8991 μM)  
  •   4  Target:  T.harzianum  MIC:  438.07 μg/ml  (90.8991 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Jakubowicz T.,Suder P.,Zdybicka-Barabas A.,Mak P.,Cytrynska M.,
  •   Title:Purification and characterization of eight peptides from Galleria mellonella immune hemolymph.
  •   Journal:Peptides, 2007, 28, 533-546  [PubMed:17194500]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: