Record in detail
General Info
- lamp_id:L01A000178
- Name:LEB1_GALME
- FullName:Lebocin-like anionic peptide 1
- Source:Galleria mellonella
- Mass:4819.3 Da
- Sequence Length:42 aa
- Isoelectric Point:4.3
- Activity:Antibacterial, Antifungal
- Sequence
EADEPLWLYKGDNIERAPTTADHPILPSIIDDVKLDPNRRYA - Function:Antimicrobial protein. Has antibacterial activity against the Gram-positive bacteria M.luteus (MIC=22.7 uM) and L.monocytogenes (MIC=90.9 uM). Lacks antibacterial activity against the Gram-positive bacteria B.circulans, S.aureus, and S.lutea, and the Gram-negative bacteria E.coli D31, E.coli ATCC 25922, and S.typhimurium. Has antifungal activity against A.niger (MIC=90.9 uM) and T.harzianum (MIC=90.9 uM), but lacks antifungal activity against S.cerevisiae, P.pastoris, Z.marxianus, C.albicans, C.fructus, and F.oxysporum.
Cross-Linking
- Cross-linking
- 1 Database:APD 749
- 2 Database:CAMP CAMPSQ164
- 3 Database:DBAASP 1236
- 4 Database:dbAMP dbAMP_01278
- 5 Database:DRAMP DRAMP03524
- 6 Database:SATPdb satpdb14695
- 7 Database:Uniprot P85211
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000178 From 1 To 42 E-value: 1e-19 Score: 87
EADEPLWLYKGDNIERAPTTADHPILPSIIDDVKLDPNRRYA - 2. L11A004128 From 3 To 43 E-value: 0.00000000000001 Score: 70.5
GNEPLWLYQGDNIPKAPSTAEHPFLPSIIDDVKFNPDRRYA - 3. L11A004127 From 3 To 43 E-value: 0.00000000000001 Score: 70.1
GNEPLWLYQGDNIPKAPSTAEHPFLPSIIDDVKFNPDRRYA
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: M. luteus MIC: 109.4 μg/ml (22.7004 μM)
- 2 Target: L.monocytogenes MIC: 438.07 μg/ml (90.8991 μM)
- 3 Target: A.niger MIC: 438.07 μg/ml (90.8991 μM)
- 4 Target: T.harzianum MIC: 438.07 μg/ml (90.8991 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Jakubowicz T.,Suder P.,Zdybicka-Barabas A.,Mak P.,Cytrynska M.,
- Title:Purification and characterization of eight peptides from Galleria mellonella immune hemolymph.
- Journal:Peptides, 2007, 28, 533-546 [PubMed:17194500]
Comments
- Comments
No comments found on LAMP database