Record in detail


General Info

  • lamp_id:L01A000179
  • Name:PROP1_GALME
  • FullName:Proline-rich antimicrobial peptide 1
  • Source:Galleria mellonella
  • Mass:4322.9 Da
  • Sequence Length:37 aa
  • Isoelectric Point:11.65
  • Activity:Antibacterial, Antifungal
  • Sequence
        DIQIPGIKKPTHRDIIIPNWNPNVRTQPWQRFGGNKS
  • Function:Antimicrobial protein. Has antibacterial activity against the Gram-positive bacterium M.luteus (MIC=55.0 uM). Lacks antibacterial activity against the Gram-positive bacteria B.circulans, and L.monocytogenes, and the Gram-negative bacteria E.coli D31 and E.coli ATCC 25922. Has antifungal activity against P.pastoris (MIC=16.5 uM), Z.marxianus (MIC=16.5 uM), S.pombe (MIC=11.0 uM), and C.wickerhami (MIC=16.5 uM), but lacks antifungal activity against A.niger and C.albidus.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000179    From 1 To 37 E-value: 1e-16 Score: 77
        DIQIPGIKKPTHRDIIIPNWNPNVRTQPWQRFGGNKS

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  P. pastoris  MIC:  21.61 μg/ml  (4.99896 μM)  
  •   2  Target:  Z. marxianus  MIC:  21.61 μg/ml  (4.99896 μM)  
  •   3  Target:  S. pombe  MIC:  21.61 μg/ml  (4.99896 μM)  
  •   4  Target:  C. wickerhamii  MIC:  21.61 μg/ml  (4.99896 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Gacek G.J.,Chmiel D.,Mak P.,
  •   Title:Antibacterial peptides of the moth Galleria mellonella.
  •   Journal:Acta Biochim. Pol., 2001, 48, 1191-1195  [PubMed:11995991]
  •   [2]  Jakubowicz T.,Suder P.,Zdybicka-Barabas A.,Mak P.,Cytrynska M.,
  •   Title:Purification and characterization of eight peptides from Galleria mellonella immune hemolymph.
  •   Journal:Peptides, 2007, 28, 533-546  [PubMed:17194500]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: