Record in detail
General Info
- lamp_id:L01A000179
- Name:PROP1_GALME
- FullName:Proline-rich antimicrobial peptide 1
- Source:Galleria mellonella
- Mass:4322.9 Da
- Sequence Length:37 aa
- Isoelectric Point:11.65
- Activity:Antibacterial, Antifungal
- Sequence
DIQIPGIKKPTHRDIIIPNWNPNVRTQPWQRFGGNKS - Function:Antimicrobial protein. Has antibacterial activity against the Gram-positive bacterium M.luteus (MIC=55.0 uM). Lacks antibacterial activity against the Gram-positive bacteria B.circulans, and L.monocytogenes, and the Gram-negative bacteria E.coli D31 and E.coli ATCC 25922. Has antifungal activity against P.pastoris (MIC=16.5 uM), Z.marxianus (MIC=16.5 uM), S.pombe (MIC=11.0 uM), and C.wickerhami (MIC=16.5 uM), but lacks antifungal activity against A.niger and C.albidus.
Cross-Linking
- Cross-linking
- 1 Database:APD 748
- 2 Database:CAMP CAMPSQ165
- 3 Database:DBAASP 1214
- 4 Database:dbAMP dbAMP_01086
- 5 Database:DRAMP DRAMP03521
- 6 Database:SATPdb satpdb14974
- 7 Database:Uniprot P85214
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000179 From 1 To 37 E-value: 1e-16 Score: 77
DIQIPGIKKPTHRDIIIPNWNPNVRTQPWQRFGGNKS
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: P. pastoris MIC: 21.61 μg/ml (4.99896 μM)
- 2 Target: Z. marxianus MIC: 21.61 μg/ml (4.99896 μM)
- 3 Target: S. pombe MIC: 21.61 μg/ml (4.99896 μM)
- 4 Target: C. wickerhamii MIC: 21.61 μg/ml (4.99896 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Gacek G.J.,Chmiel D.,Mak P.,
- Title:Antibacterial peptides of the moth Galleria mellonella.
- Journal:Acta Biochim. Pol., 2001, 48, 1191-1195 [PubMed:11995991]
- [2] Jakubowicz T.,Suder P.,Zdybicka-Barabas A.,Mak P.,Cytrynska M.,
- Title:Purification and characterization of eight peptides from Galleria mellonella immune hemolymph.
- Journal:Peptides, 2007, 28, 533-546 [PubMed:17194500]
Comments
- Comments
No comments found on LAMP database