Record in detail


General Info

  • lamp_id:L01A000194
  • Name:sperm associated antigen 11 isoform C
  • FullName:sperm associated antigen 11 isoform C
  • Source:Macaca mulatta (rhesus monkey)
  • Mass:6235.1 Da
  • Sequence Length:53 aa
  • Isoelectric Point:7.03
  • Activity:Antibacterial
  • Sequence
        APIIRRIPYYPEVESDLRIVDCKRSEGFCQEYCNYLETQVGYCSKKKDACCLH
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000194    From 1 To 53 E-value: 7e-27 Score: 110
        APIIRRIPYYPEVESDLRIVDCKRSEGFCQEYCNYLETQVGYCSKKKDACCLH
  • 2. L01A002432    From 6 To 53 E-value: 7e-18 Score: 80.9
        RTPPYQEPASDLKVVDFRRSEGFCQEYCNYMETQVGYCPKKKDACCLH
  • 3. L01A002596    From 1 To 34 E-value: 0.000000000000003 Score: 72
        RIVDCKRSEGFCQEYCNYLETQVGYCSKKKDACC
  • 4. L01A002500    From 1 To 32 E-value: 0.0000000000001 Score: 66.6
        VDCRRSEGFCQEYCNYMETQVGYCSKKKDACC
  • 5. L01A002555    From 1 To 34 E-value: 0.000000000003 Score: 62.4
        QIVNCKKNEGFCQKYCNFMETQVGYCSKKKEACC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E.coli  MIC:  50 μg/ml  (8.01912 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: