Record in detail
General Info
- lamp_id:L01A000208
- Name:AMP1_MIRJA
- FullName:Antimicrobial peptide 1
- Source:Mirabilis jalapa
- Mass:4000.5 Da
- Sequence Length:37 aa
- Isoelectric Point:8.38
- Activity:Antibacterial, Antifungal
- Sequence
QCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR - Function:Possesses antifungal activity and is also active on two tested Gram-positive bacteria but is non-toxic for Gram-negative bacteria and cultured human cells.
Cross-Linking
- Cross-linking
- 1 Database:APD 203
- 2 Database:CAMP CAMPSQ187
- 3 Database:dbAMP dbAMP_10048
- 4 Database:DRAMP DRAMP01016
- 5 Database:SATPdb satpdb24021
- 6 Database:Uniprot P25403
- 7 Database:PHY PHYT00270
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L03A000073 From 25 To 61 E-value: 2e-17 Score: 79
QCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR - 2. L01A000208 From 1 To 37 E-value: 4e-16 Score: 75.1
QCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR - 3. L11A001642 From 2 To 37 E-value: 0.000000000000001 Score: 73.2
CIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR - 4. L03A000097 From 28 To 63 E-value: 0.000000000000003 Score: 72
CIGNGGRCNENVGPPYCCSGFCLRQPNQGYGVCRNR - 5. L01A000209 From 1 To 36 E-value: 0.00000000000004 Score: 68.2
CIGNGGRCNENVGPPYCCSGFCLRQPNQGYGVCRNR
Activity
- Antibacterial Activities
- 1 Target: Alternaria brassicola MIC: 20 μg/ml (4.99937 μM)
- 2 Target: Ascochyta pisi MIC: 200 μg/ml (49.9938 μM)
- 3 Target: Botrytis cinerea MIC: 50 μg/ml (12.4984 μM)
- 4 Target: Cercospora beticola MIC: 10 μg/ml (2.49969 μM)
- 5 Target: Colletotrichum lindemuthianum MIC: 6 μg/ml (1.49981 μM)
- 6 Target: Fusarium culmorum MIC: 30 μg/ml (7.49906 μM)
- 7 Target: Fusarium oxysporum f.sp.pisi MIC: 15 μg/ml (3.74953 μM)
- 8 Target: Fusarium oxysporum f.sp.lycopersici MIC: 200 μg/ml (49.9938 μM)
- 9 Target: Nectria haematococca MIC: 15 μg/ml (3.74953 μM)
- 10 Target: Phoma betae MIC: 25 μg/ml (6.24922 μM)
- 11 Target: Pyrenophora tritici-repentis MIC: 300 μg/ml (74.9906 μM)
- 12 Target: Pyricularia oryzae MIC: 6 μg/ml (1.49981 μM)
- 13 Target: Rhizoctonia solani MIC: 60 μg/ml (14.9981 μM)
- 14 Target: Verticillium dahliae MIC: 12 μg/ml (2.99962 μM)
- 15 Target: Venturia inequalis MIC: 12 μg/ml (2.99962 μM)
- 16 Target: B.megaterium MIC: 6 μg/ml (1.49981 μM)
- 17 Target: Sarcina lutea MIC: 100 μg/ml (24.9969 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] van Damme J.,Proost P.,Terras F.R.G.,de Bolle M.F.C.,Cammue B.P.A.,
- Title:Isolation and characterization of a novel class of plant antimicrobial peptides from Mirabilis jalapa L. seeds.
- Journal:J. Biol. Chem., 1992, 267, 2228-2233 [MEDLINE:92129292]
- [2] Terras F.R.G.,Osborn R.W.,Duncan R.E.,Eggermont K.,de Bolle M.F.,
- Title:Cloning and characterization of two cDNA clones encoding seed-specific antimicrobial peptides from Mirabilis jalapa L.
- Journal:Plant Mol. Biol., 1995, 28, 713-721 [MEDLINE:95375234]
Comments
- Comments
No comments found on LAMP database