Record in detail


General Info

  • lamp_id:L01A000208
  • Name:AMP1_MIRJA
  • FullName:Antimicrobial peptide 1
  • Source:Mirabilis jalapa
  • Mass:4000.5 Da
  • Sequence Length:37 aa
  • Isoelectric Point:8.38
  • Activity:Antibacterial, Antifungal
  • Sequence
        QCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR
  • Function:Possesses antifungal activity and is also active on two tested Gram-positive bacteria but is non-toxic for Gram-negative bacteria and cultured human cells.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000073    From 25 To 61 E-value: 2e-17 Score: 79
        QCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR
  • 2. L01A000208    From 1 To 37 E-value: 4e-16 Score: 75.1
        QCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR
  • 3. L11A001642    From 2 To 37 E-value: 0.000000000000001 Score: 73.2
        CIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR
  • 4. L03A000097    From 28 To 63 E-value: 0.000000000000003 Score: 72
        CIGNGGRCNENVGPPYCCSGFCLRQPNQGYGVCRNR
  • 5. L01A000209    From 1 To 36 E-value: 0.00000000000004 Score: 68.2
        CIGNGGRCNENVGPPYCCSGFCLRQPNQGYGVCRNR

Structure

  •   Domains
  •   1  Name:Antimicrobial_C6_CS    Interpro Link:IPR013006
  •   2  Name:Gurmarin/antifun_pep    Interpro Link:IPR009101
  •   3  Name:Gurmarin/antimicrobial_peptd    Interpro Link:IPR024206
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Alternaria brassicola  MIC:  20 μg/ml  (4.99937 μM)  
  •   2  Target:  Ascochyta pisi  MIC:  200 μg/ml  (49.9938 μM)  
  •   3  Target:  Botrytis cinerea  MIC:  50 μg/ml  (12.4984 μM)  
  •   4  Target:  Cercospora beticola  MIC:  10 μg/ml  (2.49969 μM)  
  •   5  Target:  Colletotrichum lindemuthianum  MIC:  6 μg/ml  (1.49981 μM)  
  •   6  Target:  Fusarium culmorum  MIC:  30 μg/ml  (7.49906 μM)  
  •   7  Target:  Fusarium oxysporum f.sp.pisi  MIC:  15 μg/ml  (3.74953 μM)  
  •   8  Target:  Fusarium oxysporum f.sp.lycopersici  MIC:  200 μg/ml  (49.9938 μM)  
  •   9  Target:  Nectria haematococca  MIC:  15 μg/ml  (3.74953 μM)  
  •   10  Target:  Phoma betae  MIC:  25 μg/ml  (6.24922 μM)  
  •   11  Target:  Pyrenophora tritici-repentis  MIC:  300 μg/ml  (74.9906 μM)  
  •   12  Target:  Pyricularia oryzae  MIC:  6 μg/ml  (1.49981 μM)  
  •   13  Target:  Rhizoctonia solani  MIC:  60 μg/ml  (14.9981 μM)  
  •   14  Target:  Verticillium dahliae  MIC:  12 μg/ml  (2.99962 μM)  
  •   15  Target:  Venturia inequalis  MIC:  12 μg/ml  (2.99962 μM)  
  •   16  Target:  B.megaterium  MIC:  6 μg/ml  (1.49981 μM)  
  •   17  Target:  Sarcina lutea  MIC:  100 μg/ml  (24.9969 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  van Damme J.,Proost P.,Terras F.R.G.,de Bolle M.F.C.,Cammue B.P.A.,
  •   Title:Isolation and characterization of a novel class of plant antimicrobial peptides from Mirabilis jalapa L. seeds.
  •   Journal:J. Biol. Chem., 1992, 267, 2228-2233  [MEDLINE:92129292]
  •   [2]  Terras F.R.G.,Osborn R.W.,Duncan R.E.,Eggermont K.,de Bolle M.F.,
  •   Title:Cloning and characterization of two cDNA clones encoding seed-specific antimicrobial peptides from Mirabilis jalapa L.
  •   Journal:Plant Mol. Biol., 1995, 28, 713-721  [MEDLINE:95375234]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: