Record in detail
General Info
- lamp_id:L01A000209
- Name:AMP2_MIRJA
- FullName:Antimicrobial peptide 2
- Source:Mirabilis jalapa
- Mass:3893.4 Da
- Sequence Length:36 aa
- Isoelectric Point:8.38
- Activity:Antibacterial, Antifungal
- Sequence
CIGNGGRCNENVGPPYCCSGFCLRQPNQGYGVCRNR - Function:Possesses antifungal activity and is also active on two tested Gram-positive bacteria but is non-toxic for Gram-negative bacteria and cultured human cells.
Cross-Linking
- Cross-linking
- 1 Database:APD 202
- 2 Database:CAMP CAMPSQ188
- 3 Database:DBAASP 1643
- 4 Database:dbAMP dbAMP_00859
- 5 Database:DRAMP DRAMP01017
- 6 Database:SATPdb satpdb25138
- 7 Database:Uniprot P25404
- 8 Database:PHY PHYT00271
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L03A000097 From 28 To 63 E-value: 1e-16 Score: 77
CIGNGGRCNENVGPPYCCSGFCLRQPNQGYGVCRNR - 2. L01A000209 From 1 To 36 E-value: 0.000000000000002 Score: 73.2
CIGNGGRCNENVGPPYCCSGFCLRQPNQGYGVCRNR - 3. L03A000073 From 26 To 61 E-value: 0.000000000000005 Score: 71.6
CIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR - 4. L01A000208 From 2 To 37 E-value: 0.00000000000005 Score: 68.2
CIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR - 5. L11A001642 From 2 To 37 E-value: 0.00000000000005 Score: 68.2
CIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR
Activity
- Antibacterial Activities
- 1 Target: Alternaria brassicola MIC: 6 μg/ml (1.54107 μM)
- 2 Target: Ascochyta pisi MIC: 6 μg/ml (1.54107 μM)
- 3 Target: Botrytis cinerea MIC: 2 μg/ml (0.51369 μM)
- 4 Target: Cercospora beticola MIC: 2 μg/ml (0.51369 μM)
- 5 Target: Colletotrichum lindemuthianum MIC: 1 μg/ml (0.256845 μM)
- 6 Target: Fusarium culmorum MIC: 3 μg/ml (0.770535 μM)
- 7 Target: Fusarium oxysporum f.sp.pisi MIC: 5 μg/ml (1.28422 μM)
- 8 Target: Fusarium oxysporum f.sp.lycopersici MIC: 10 μg/ml (2.56845 μM)
- 9 Target: Nectria haematococca MIC: 0.5 μg/ml (0.128422 μM)
- 10 Target: Phoma betae MIC: 6 μg/ml (1.54107 μM)
- 11 Target: Pyrenophora tritici-repentis MIC: 20 μg/ml (5.1369 μM)
- 12 Target: Pyricularia oryzae MIC: 0.5 μg/ml (0.128422 μM)
- 13 Target: Rhizoctonia solani MIC: 15 μg/ml (3.85267 μM)
- 14 Target: Verticillium dahliae MIC: 0.5 μg/ml (0.128422 μM)
- 15 Target: Venturia inequalis MIC: 1 μg/ml (0.256845 μM)
- 16 Target: B.megaterium MIC: 2 μg/ml (0.51369 μM)
- 17 Target: Sarcina lutea MIC: 50 μg/ml (12.8422 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] van Damme J.,Proost P.,Terras F.R.G.,de Bolle M.F.C.,Cammue B.P.A.,
- Title:Isolation and characterization of a novel class of plant antimicrobial peptides from Mirabilis jalapa L. seeds.
- Journal:J. Biol. Chem., 1992, 267, 2228-2233 [MEDLINE:92129292]
- [2] Terras F.R.G.,Osborn R.W.,Duncan R.E.,Eggermont K.,de Bolle M.F.,
- Title:Cloning and characterization of two cDNA clones encoding seed-specific antimicrobial peptides from Mirabilis jalapa L.
- Journal:Plant Mol. Biol., 1995, 28, 713-721 [MEDLINE:95375234]
Comments
- Comments
No comments found on LAMP database