Record in detail

lamp_id:L01A000210
Name:AMP_AMACA
FullName:Antimicrobial peptide 2
Source:Amaranthus caudatus
Mass:3189.7 Da
Sequence Length:30 aa
Isoelectric Point:8.62
Activity:Antibacterial, Antifungal
Sequence
VGECVRGRCPSGMCCSQFGYCGKGPKYCGR
Function:Chitin-binding protein with a defensive function against numerous chitin containing fungal pathogens. It is also a potent inhibitor of Gram-positive bacteria.

Top similar AMPs on LAMP
1. L03A000310 From 26 To 55 E-value: 0.0000000000002 Score: 66.2
VGECVRGRCPSGMCCSQFGYCGKGPKYCGR
2. L12A09584| From 27 To 55 E-value: 0.000000000005 Score: 61.6
GECVQGRCPSGMCCSQFGYCGRGPKYCGR
3. L01A000210 From 1 To 30 E-value: 0.000000000008 Score: 60.8
VGECVRGRCPSGMCCSQFGYCGKGPKYCGR
4. L12A11744| From 1 To 30 E-value: 0.00000000002 Score: 60.1
VGECVRGRCPSGMCCSQFGFCGKGPKYCGR
5. L12A11747| From 1 To 30 E-value: 0.00000000002 Score: 59.7
VGECVRGRCPSGMCCSQWGYCGKGPKYCGR

Reference
[1] Proost P.,de Bolle M.F.C.,Terras F.R.G.,Marien W.,Broekaert W.F.,
Title:Antimicrobial peptides from Amaranthus caudatus seeds with sequence homology to the cysteine/glycine-rich domain of chitin-binding proteins.
Journal:Biochemistry, 1992, 31, 4308-4314 [MEDLINE:92232738]
[2] Cammue B.P.A.,Vanderleyden J.,Rees S.B.,David K.M.M.,de Bolle M.F.C.,
Title:Cloning and characterization of a cDNA encoding an antimicrobial chitin-binding protein from amaranth, Amaranthus caudatus.
Journal:Plant Mol. Biol., 1993, 22, 1187-1190 [MEDLINE:94003078]
[3] Wyns L.,Pepermans H.A.M.,Loris R.,Maes D.,Martins J.C.,
Title:H NMR study of the solution structure of Ac-AMP2, a sugar binding antimicrobial protein isolated from Amaranthus caudatus.
Journal:J. Mol. Biol., 1996, 258, 322-333 [MEDLINE:96196483]
[4] Tourwe D.,Wyns L.,Verheyden P.,Laus G.,el Boiyoussfi M.,
Title:Location of the three disulfide bonds in an antimicrobial peptide from Amaranthus caudatus using mass spectrometry.
Journal:J. Pept. Res., 1997, 49, 336-340 [MEDLINE:97319931]