Record in detail


General Info

  • lamp_id:L01A000215
  • Name:DMS1_PHYBI
  • FullName:Dermaseptin BI
  • Source:Phyllomedusa bicolor
  • Mass:3164.7 Da
  • Sequence Length:31 aa
  • Isoelectric Point:10.33
  • Activity:Antibacterial, Antifungal
  • Sequence
        AMWKDVLKKIGTVALHAGKAALGAVADTISQ
  • Function:Possesses a potent antimicrobial activity against bacteria, fungi and protozoa. Probably acts by disturbing membrane functions with its amphipathic structure.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06182|    From 45 To 75 E-value: 0.000000000001 Score: 63.5
        AMWKDVLKKIGTVALHAGKAALGAVADTISQ
  • 2. L12A06611|    From 45 To 75 E-value: 0.000000000001 Score: 63.5
        AMWKDVLKKIGTVALHAGKAALGAVADTISQ
  • 3. L01A000215    From 1 To 31 E-value: 0.000000000008 Score: 60.8
        AMWKDVLKKIGTVALHAGKAALGAVADTISQ
  • 4. L02A000956    From 1 To 31 E-value: 0.00000000002 Score: 59.3
        ALWKDVLKKIGTVALHAGKAALGAVADTISQ
  • 5. L11A012112    From 1 To 31 E-value: 0.0000000005 Score: 54.7
        ALWKTMLKKLGTVALHAGKAALGAVADTISQ

Structure

  •   Domains
  •   1  Name:Brevinin    Interpro Link:IPR004275
  •   2  Name:Dermaseptin    Interpro Link:IPR022731
  •   3  Name:Dermaseptin_precursor    Interpro Link:IPR016322
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E. coli  MIC:  4.74705 μg/ml  (1.5 μM)  
  •   2  Target:  S. aureus  MIC:  39.5588 μg/ml  (12.5 μM)  

Toxicity

  •   Toxicity

Reference

  •   Reference
  •   [1]  Nicolas P.,Mor A.,
  •   Title:Isolation and structure of novel defensive peptides from frog skin.
  •   Journal:Eur. J. Biochem., 1994, 219, 145-154  [MEDLINE:94139686]
  •   [2]  Menez A.,Boulain J.-C.,Mor A.,Ducancel F.,Amiche M.,
  •   Title:Precursors of vertebrate peptide antibiotics dermaseptin b and adenoregulin have extensive sequence identities with precursors of opioid peptides dermorphin, dermenkephalin, and deltorphins.
  •   Journal:J. Biol. Chem., 1994, 269, 17847-17852  [MEDLINE:94299491]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: