Record in detail
General Info
- lamp_id:L01A000215
- Name:DMS1_PHYBI
- FullName:Dermaseptin BI
- Source:Phyllomedusa bicolor
- Mass:3164.7 Da
- Sequence Length:31 aa
- Isoelectric Point:10.33
- Activity:Antibacterial, Antifungal
- Sequence
AMWKDVLKKIGTVALHAGKAALGAVADTISQ - Function:Possesses a potent antimicrobial activity against bacteria, fungi and protozoa. Probably acts by disturbing membrane functions with its amphipathic structure.
Cross-Linking
- Cross-linking
- 1 Database:APD 293
- 2 Database:CAMP CAMPSQ194
- 3 Database:DBAASP 10919
- 4 Database:dbAMP dbAMP_00419
- 5 Database:DRAMP DRAMP01649
- 6 Database:SATPdb satpdb14434
- 7 Database:Uniprot P80282
- 8 Database:AMD DMS1_PHYBI
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A06182| From 45 To 75 E-value: 0.000000000001 Score: 63.5
AMWKDVLKKIGTVALHAGKAALGAVADTISQ - 2. L12A06611| From 45 To 75 E-value: 0.000000000001 Score: 63.5
AMWKDVLKKIGTVALHAGKAALGAVADTISQ - 3. L01A000215 From 1 To 31 E-value: 0.000000000008 Score: 60.8
AMWKDVLKKIGTVALHAGKAALGAVADTISQ - 4. L02A000956 From 1 To 31 E-value: 0.00000000002 Score: 59.3
ALWKDVLKKIGTVALHAGKAALGAVADTISQ - 5. L11A012112 From 1 To 31 E-value: 0.0000000005 Score: 54.7
ALWKTMLKKLGTVALHAGKAALGAVADTISQ
Activity
- Antibacterial Activities
- 1 Target: E. coli MIC: 4.74705 μg/ml (1.5 μM)
- 2 Target: S. aureus MIC: 39.5588 μg/ml (12.5 μM)
Toxicity
- Toxicity
Reference
- Reference
- [1] Nicolas P.,Mor A.,
- Title:Isolation and structure of novel defensive peptides from frog skin.
- Journal:Eur. J. Biochem., 1994, 219, 145-154 [MEDLINE:94139686]
- [2] Menez A.,Boulain J.-C.,Mor A.,Ducancel F.,Amiche M.,
- Title:Precursors of vertebrate peptide antibiotics dermaseptin b and adenoregulin have extensive sequence identities with precursors of opioid peptides dermorphin, dermenkephalin, and deltorphins.
- Journal:J. Biol. Chem., 1994, 269, 17847-17852 [MEDLINE:94299491]
Comments
- Comments
No comments found on LAMP database