Record in detail


General Info

  • lamp_id:L01A000225
  • Name:CYLA_PSYLO
  • FullName:Cyclopsychotride-A
  • Source:Psychotria longipes
  • Mass:3254.9 Da
  • Sequence Length:31 aa
  • Isoelectric Point:8.11
  • Activity:Antibacterial
  • Sequence
        SIPCGESCVFIPCTVTALLGCSCKSKVCYKN
  • Function:Probably participates in a plant defense mechanism. Has antibiotic activity. Inhibits the cytopathic effects and replication of the human immunodeficiency virus. Active against both Gram-positive and Gram-negative bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000225    From 1 To 31 E-value: 0.000000000002 Score: 62.8
        SIPCGESCVFIPCTVTALLGCSCKSKVCYKN
  • 2. L13A019809    From 1 To 31 E-value: 0.00000000001 Score: 60.5
        GIPCGESCVFIPCTVTALLGCSCKDKVCYKN
  • 3. L12A06270|    From 46 To 75 E-value: 0.00000000002 Score: 59.3
        IPCAESCVYIPCTITALLGCSCKDKVCYKN
  • 4. L13A012166    From 1 To 31 E-value: 0.00000000003 Score: 59.3
        GIPCGESCVYIPCTVTALLGCSCKDKVCYKN
  • 5. L12A06267|    From 46 To 75 E-value: 0.0000000002 Score: 56.6
        FPCAESCVYIPCTVTALLGCSCRNRVCYRN

Structure

  •   Domains
  •   1  Name:Cyclotide    Interpro Link:IPR005535
  •   2  Name:Cyclotide_bracelet_CS    Interpro Link:IPR012323
  •   3  Name:Cyclotide_subgr    Interpro Link:IPR017307
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E. coli  MIC:  5.05 μg/ml  (1.55151 μM)  
  •   2  Target:  P.aeruginosa  MIC:  43.94 μg/ml  (13.4996 μM)  
  •   3  Target:  Pr.vulgaris  MIC:  42.96 μg/ml  (13.1986 μM)  
  •   4  Target:  K. oxytoca  MIC:  18.88 μg/ml  (5.80049 μM)  
  •   5  Target:  S. aureus  MIC:  126.94 μg/ml  (38.9997 μM)  
  •   6  Target:  M. luteus  MIC:  156.24 μg/ml  (48.0015 μM)  
  •   7  Target:  C. albicans  MIC:  1627.45 μg/ml  (500 μM)  
  •   8  Target:  C. kefyr  MIC:  45.57 μg/ml  (14.0004 μM)  
  •   9  Target:  C. tropicalis  MIC:  183.9 μg/ml  (56.4994 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ransom R.W.,Ramjit H.,Anderson P.S.,Bogusky M.J.,Witherup K.M.,
  •   Title:Cyclopsychotride A, a biologically active, 31-residue cyclic peptide isolated from Psychotria longipes.
  •   Journal:J. Nat. Prod., 1994, 57, 1619-1625  [MEDLINE:95230294]
  •   [2]  Chiu K.-W.,Yang J.-L.,Lu Y.-A.,Tam J.P.,
  •   Title:An unusual structural motif of antimicrobial peptides containing end-to-end macrocycle and cystine-knot disulfides.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 1999, 96, 8913-8918  [MEDLINE:99362685]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: