Record in detail
General Info
- lamp_id:L01A000234
- Name:PCG3_PACGO
- FullName:Ponericin-G3
- Source:Pachycondyla goeldii
- Mass:3383.1 Da
- Sequence Length:30 aa
- Isoelectric Point:11.02
- Activity:Antibacterial, Antifungal
- Sequence
GWKDWLNKGKEWLKKKGPGIMKAALKAATQ - Function:Broad spectrum of activity against both Gram-positive and Gram-negative bacteria and S.cerevisiae. Has insecticidal and non-hemolytic activities.
Cross-Linking
- Cross-linking
- 1 Database:APD 378
- 2 Database:CAMP CAMPSQ212
- 3 Database:DBAASP 4268
- 4 Database:dbAMP dbAMP_04354
- 5 Database:DRAMP DRAMP02755
- 6 Database:SATPdb satpdb10915
- 7 Database:Uniprot P82416
- 8 Database:AMD PCG3_PACGO
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000234 From 1 To 30 E-value: 0.00000000003 Score: 58.9
GWKDWLNKGKEWLKKKGPGIMKAALKAATQ - 2. L01A000233 From 1 To 30 E-value: 0.000000003 Score: 52.4
GWKDWLKKGKEWLKAKGPGIVKAALQAATQ - 3. L01A000235 From 2 To 29 E-value: 0.000008 Score: 40.8
FKDWMKTAGEWLKKKGPGILKAAMAAAT - 4. L01A000236 From 1 To 30 E-value: 0.00002 Score: 40
GLKDWVKIAGGWLKKKGPGILKAAMAAATQ - 5. L01A000232 From 1 To 19 E-value: 0.036 Score: 28.9
GWKDWAKKAGGWLKKKGPG
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Revol-Junelles A.-M.,Krier F.,Le Caer J.-P.,Redeker V.,Orivel J.,
- Title:Ponericins, new antibacterial and insecticidal peptides from the venom of the ant Pachycondyla goeldii.
- Journal:J. Biol. Chem., 2001, 276, 17823-17829 [MEDLINE:21264562]
Comments
- Comments
No comments found on LAMP database