Record in detail
General Info
- lamp_id:L01A000236
- Name:PCG5_PACGO
- FullName:Ponericin-G5
- Source:Pachycondyla goeldii
- Mass:3108.8 Da
- Sequence Length:30 aa
- Isoelectric Point:11.1
- Activity:Antibacterial
- Sequence
GLKDWVKIAGGWLKKKGPGILKAAMAAATQ - Function:Has antibacterial activity and non-hemolytic activities.
Cross-Linking
- Cross-linking
- 1 Database:APD 380
- 2 Database:CAMP CAMPSQ214
- 3 Database:dbAMP dbAMP_03475
- 4 Database:DRAMP DRAMP02757
- 5 Database:SATPdb satpdb15070
- 6 Database:Uniprot P82418
- 7 Database:AMD PCG5_PACGO
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000236 From 1 To 30 E-value: 0.00000000006 Score: 57.8
GLKDWVKIAGGWLKKKGPGILKAAMAAATQ - 2. L01A000235 From 2 To 29 E-value: 0.00000006 Score: 48.1
FKDWMKTAGEWLKKKGPGILKAAMAAAT - 3. L01A000234 From 1 To 30 E-value: 0.00002 Score: 40
GWKDWLNKGKEWLKKKGPGIMKAALKAATQ - 4. L01A000233 From 1 To 30 E-value: 0.00003 Score: 38.9
GWKDWLKKGKEWLKAKGPGIVKAALQAATQ - 5. L01A000232 From 1 To 19 E-value: 0.002 Score: 33.1
GWKDWAKKAGGWLKKKGPG
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Revol-Junelles A.-M.,Krier F.,Le Caer J.-P.,Redeker V.,Orivel J.,
- Title:Ponericins, new antibacterial and insecticidal peptides from the venom of the ant Pachycondyla goeldii.
- Journal:J. Biol. Chem., 2001, 276, 17823-17829 [MEDLINE:21264562]
Comments
- Comments
No comments found on LAMP database