Record in detail


General Info

  • lamp_id:L01A000236
  • Name:PCG5_PACGO
  • FullName:Ponericin-G5
  • Source:Pachycondyla goeldii
  • Mass:3108.8 Da
  • Sequence Length:30 aa
  • Isoelectric Point:11.1
  • Activity:Antibacterial
  • Sequence
        GLKDWVKIAGGWLKKKGPGILKAAMAAATQ
  • Function:Has antibacterial activity and non-hemolytic activities.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000236    From 1 To 30 E-value: 0.00000000006 Score: 57.8
        GLKDWVKIAGGWLKKKGPGILKAAMAAATQ
  • 2. L01A000235    From 2 To 29 E-value: 0.00000006 Score: 48.1
        FKDWMKTAGEWLKKKGPGILKAAMAAAT
  • 3. L01A000234    From 1 To 30 E-value: 0.00002 Score: 40
        GWKDWLNKGKEWLKKKGPGIMKAALKAATQ
  • 4. L01A000233    From 1 To 30 E-value: 0.00003 Score: 38.9
        GWKDWLKKGKEWLKAKGPGIVKAALQAATQ
  • 5. L01A000232    From 1 To 19 E-value: 0.002 Score: 33.1
        GWKDWAKKAGGWLKKKGPG

Structure

  •   Domains
  •   1  Name:Ponericin    Interpro Link:IPR010002
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Revol-Junelles A.-M.,Krier F.,Le Caer J.-P.,Redeker V.,Orivel J.,
  •   Title:Ponericins, new antibacterial and insecticidal peptides from the venom of the ant Pachycondyla goeldii.
  •   Journal:J. Biol. Chem., 2001, 276, 17823-17829  [MEDLINE:21264562]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: