Record in detail


General Info

  • lamp_id:L01A000268
  • Name:DEFA4_MOUSE
  • FullName:Alpha-defensin 4
  • Source:Mus musculus
  • Mass:3761.5 Da
  • Sequence Length:32 aa
  • Isoelectric Point:10.02
  • Activity:Antibacterial
  • Sequence
        GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR
  • Function:Probably contributes to the antimicrobial barrier function of the small bowel mucosa.

Cross-Linking

  •   Cross-linking
  •   1  Database:APD  285
  •   2  Database:CAMP  CAMPSQ1189
  •   3  Database:DBAASP  4889
  •   4  Database:dbAMP  dbAMP_03491
  •   5  Database:SATPdb  satpdb16826
  •   6  Database:Uniprot  P28311

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08329|    From 61 To 92 E-value: 0.00000000000002 Score: 69.7
        GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR
  • 2. L03A000076    From 58 To 89 E-value: 0.00000000000002 Score: 69.3
        GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR
  • 3. L05ADEF199    From 3 To 34 E-value: 0.0000000000009 Score: 63.9
        GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR
  • 4. L01A000268    From 1 To 32 E-value: 0.0000000000009 Score: 63.9
        GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR
  • 5. L12A03490|    From 1 To 32 E-value: 0.000000000002 Score: 63.2
        GLLCYCRKGHCKRGDRVRGTCGIRFLYCCPRR

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ouellette A.J.,Henschen A.H.,Miller S.I.,Selsted M.E.,
  •   Title:Enteric defensins: antibiotic peptide components of intestinal host defense.
  •   Journal:J. Cell Biol., 1992, 118, 929-936  [MEDLINE:92363933]
  •   [2]  Huttner K.M.,Cano-Gauci D.F.,Nosek M.T.,Hsieh M.M.,Ouellette A.J.,
  •   Title:Mouse Paneth cell defensins: primary structures and antibacterial activities of numerous cryptdin isoforms.
  •   Journal:Infect. Immun., 1994, 62, 5040-5047  [MEDLINE:95012724]
  •   [3]  Ouellette A.J.,Selsted M.E.,Huttner K.M.,
  •   Title:Structure and diversity of the murine cryptdin gene family.
  •   Journal:Genomics, 1994, 19, 448-453  [MEDLINE:94245232]
  •   [4]  Yuan J.,Huttner K.M.,Tran D.,Darmoul D.,Ouellette A.J.,
  •   Title:Peptide localization and gene structure of cryptdin 4, a differentially expressed mouse Paneth cell alpha-defensin.
  •   Journal:Infect. Immun., 1999, 67, 6643-6651  [MEDLINE:20038333]
  •   [5]  Vogel H.J.,Ouellette A.J.,Tanabe H.,Hunter H.N.,Jing W.,
  •   Title:Solution structure of cryptdin-4, a mouse paneth cell alpha-defensin.
  •   Journal:Biochemistry, 2004, 43, 15759-15766  [PubMed:15595831]
  •   [6]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: