Record in detail
General Info
- lamp_id:L01A000268
- Name:DEFA4_MOUSE
- FullName:Alpha-defensin 4
- Source:Mus musculus
- Mass:3761.5 Da
- Sequence Length:32 aa
- Isoelectric Point:10.02
- Activity:Antibacterial
- Sequence
GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR - Function:Probably contributes to the antimicrobial barrier function of the small bowel mucosa.
Cross-Linking
- Cross-linking
- 1 Database:APD 285
- 2 Database:CAMP CAMPSQ1189
- 3 Database:DBAASP 4889
- 4 Database:dbAMP dbAMP_03491
- 5 Database:SATPdb satpdb16826
- 6 Database:Uniprot P28311
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A08329| From 61 To 92 E-value: 0.00000000000002 Score: 69.7
GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR - 2. L03A000076 From 58 To 89 E-value: 0.00000000000002 Score: 69.3
GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR - 3. L05ADEF199 From 3 To 34 E-value: 0.0000000000009 Score: 63.9
GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR - 4. L01A000268 From 1 To 32 E-value: 0.0000000000009 Score: 63.9
GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR - 5. L12A03490| From 1 To 32 E-value: 0.000000000002 Score: 63.2
GLLCYCRKGHCKRGDRVRGTCGIRFLYCCPRR
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Ouellette A.J.,Henschen A.H.,Miller S.I.,Selsted M.E.,
- Title:Enteric defensins: antibiotic peptide components of intestinal host defense.
- Journal:J. Cell Biol., 1992, 118, 929-936 [MEDLINE:92363933]
- [2] Huttner K.M.,Cano-Gauci D.F.,Nosek M.T.,Hsieh M.M.,Ouellette A.J.,
- Title:Mouse Paneth cell defensins: primary structures and antibacterial activities of numerous cryptdin isoforms.
- Journal:Infect. Immun., 1994, 62, 5040-5047 [MEDLINE:95012724]
- [3] Ouellette A.J.,Selsted M.E.,Huttner K.M.,
- Title:Structure and diversity of the murine cryptdin gene family.
- Journal:Genomics, 1994, 19, 448-453 [MEDLINE:94245232]
- [4] Yuan J.,Huttner K.M.,Tran D.,Darmoul D.,Ouellette A.J.,
- Title:Peptide localization and gene structure of cryptdin 4, a differentially expressed mouse Paneth cell alpha-defensin.
- Journal:Infect. Immun., 1999, 67, 6643-6651 [MEDLINE:20038333]
- [5] Vogel H.J.,Ouellette A.J.,Tanabe H.,Hunter H.N.,Jing W.,
- Title:Solution structure of cryptdin-4, a mouse paneth cell alpha-defensin.
- Journal:Biochemistry, 2004, 43, 15759-15766 [PubMed:15595831]
- [6]
- Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
- Journal:Genome Res., 2004, 14, 2121-2127 [PubMed:15489334]
Comments
- Comments
No comments found on LAMP database