Record in detail


General Info

  • lamp_id:L01A000269
  • Name:TOP1_OXYTA
  • FullName:M-oxotoxin-Ot1a
  • Source:Oxyopes takobius
  • Mass:5221.3 Da
  • Sequence Length:48 aa
  • Isoelectric Point:11.92
  • Activity:Antibacterial
  • Sequence
        FRGLAKLLKIGLKSFARVLKKVLPKAAKAGKALAKSMADENAIRQQNQ
  • Function:Disrupts cell membranes, particularly those rich in phosphocholine, through formation of pores. Has antimicrobial activity against Gram-negative bacterium E.coli, Gram-positive bacteria B.subtilis and S.aureus, and hemolytic activity against sheep, pig and guinea pig erythrocytes. Has insecticidal activity against S.frugiperda ovarian cells by opening non-selective ion channels. Enhances the insecticidal activity of spider venom neurotoxic peptides.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000269    From 1 To 48 E-value: 4e-21 Score: 91.7
        FRGLAKLLKIGLKSFARVLKKVLPKAAKAGKALAKSMADENAIRQQNQ
  • 2. L12A07247|    From 39 To 68 E-value: 3.5 Score: 22.3
        RGLFSILKIGAKVIG---KNLLKQAGKAGMEYA
  • 3. L12A06977|    From 39 To 68 E-value: 4.7 Score: 21.6
        RGLFSILKIGAKVIG---KSLLKQAGKAGMEYA
  • 4. L12A07012|    From 39 To 68 E-value: 5.7 Score: 21.6
        RGLFSILKIG----AEVIGKNLLKQAGKAGMEYA
  • 5. L12A07243|    From 39 To 75 E-value: 6.7 Score: 21.2
        RGIFSLFKAGAKFFG---KHLLKQAGKAG-------AEHLACKATNQ

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E. coli  MIC:  31.33 μg/ml  (6.00042 μM)  
  •   2  Target:  B. subtilis S. aureus  MIC:  10.44 μg/ml  (1.9995 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Belokoneva O.S.,Possani L.D.,Gomez-Lagunas F.,Villegas E.,Corzo G.,
  •   Title:Oxyopinins, large amphipathic peptides isolated from the venom of the wolf spider Oxyopes kitabensis with cytolytic properties and positive insecticidal cooperativity with spider neurotoxins.
  •   Journal:J. Biol. Chem., 2002, 277, 23627-23637  [MEDLINE:22075178]
  •   [2]  Villegas E.,Pal"mina N.P.,Mal"tseva E.L.,Satake H.,Belokoneva O.S.,
  •   Title:Pore formation of phospholipid membranes by the action of two hemolytic arachnid peptides of different size.
  •   Journal:Biochim. Biophys. Acta, 2004, 1664, 182-188  [PubMed:15328050]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: