Record in detail


General Info

  • lamp_id:L01A000288
  • Name:RUGB_GLARU
  • FullName:Rugosin-B
  • Source:Glandirana rugosa
  • Mass:3516.2 Da
  • Sequence Length:33 aa
  • Isoelectric Point:10.3
  • Activity:Antibacterial
  • Sequence
        SLFSLIKAGAKFLGKNLLKQGAQYAACKVSKEC
  • Function:Shows antibacterial activity against both Gram-negative and Gram-positive bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000288    From 1 To 33 E-value: 0.0000000000004 Score: 65.1
        SLFSLIKAGAKFLGKNLLKQGAQYAACKVSKEC
  • 2. L01A000076    From 1 To 33 E-value: 0.00000000005 Score: 58.2
        SLFSLIKAGAKFLGKNLLKQGACYAACKASKQC
  • 3. L12A07228|    From 40 To 76 E-value: 0.000002 Score: 42.7
        SIFSLFKAGAKFFGKNLLKEAGKAGAAHLACKATNQC
  • 4. L12A07247|    From 41 To 76 E-value: 0.000003 Score: 42.4
        LFSILKIGAKVIGKNLLKQAGKAGMEYAACKATNQC
  • 5. L13A025266    From 1 To 37 E-value: 0.000003 Score: 42.4
        SIFSLFKAGAKFFGKNLLKEAGKAGAAHLACKATNQC

Structure

  •   Domains
  •   1  Name:Antimicrobial_frog_2    Interpro Link:IPR012521
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus aureus 209P  MIC:  6.25 μg/ml  (1.77749 μM)  
  •   2  Target:  Bacillus subtilis ATCC6633  MIC:  6.25 μg/ml  (1.77749 μM)  
  •   3  Target:  Micrococcus luteus ATCC9341  MIC:  1.56 μg/ml  (0.443661 μM)  
  •   4  Target:  Streptococcus pyogenes COOK  MIC:  12.5 μg/ml  (3.55497 μM)  
  •   5  Target:  Eschericia coli NIHJ  MIC:  12.5 μg/ml  (3.55497 μM)  
  •   6  Target:  Pseudomonas aeruginosa PAO-1  MIC:  100 μg/ml  (28.4398 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Tatemoto K.,Kagegawa T.,Ohe Y.,Suzuki S.,
  •   Title:Isolation and characterization of novel antimicrobial peptides, rugosins A, B and C, from the skin of the frog, Rana rugosa.
  •   Journal:Biochem. Biophys. Res. Commun., 1995, 212, 249-254  [MEDLINE:95336450]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: