Record in detail
General Info
- lamp_id:L01A000288
- Name:RUGB_GLARU
- FullName:Rugosin-B
- Source:Glandirana rugosa
- Mass:3516.2 Da
- Sequence Length:33 aa
- Isoelectric Point:10.3
- Activity:Antibacterial
- Sequence
SLFSLIKAGAKFLGKNLLKQGAQYAACKVSKEC - Function:Shows antibacterial activity against both Gram-negative and Gram-positive bacteria.
Cross-Linking
- Cross-linking
- 1 Database:APD 92
- 2 Database:CAMP CAMPSQ265
- 3 Database:DBAASP 846
- 4 Database:dbAMP dbAMP_11110
- 5 Database:DRAMP DRAMP01521
- 6 Database:SATPdb satpdb21709
- 7 Database:Uniprot P80955
- 8 Database:AMD RGSNB_RANRU
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000288 From 1 To 33 E-value: 0.0000000000004 Score: 65.1
SLFSLIKAGAKFLGKNLLKQGAQYAACKVSKEC - 2. L01A000076 From 1 To 33 E-value: 0.00000000005 Score: 58.2
SLFSLIKAGAKFLGKNLLKQGACYAACKASKQC - 3. L12A07228| From 40 To 76 E-value: 0.000002 Score: 42.7
SIFSLFKAGAKFFGKNLLKEAGKAGAAHLACKATNQC - 4. L12A07247| From 41 To 76 E-value: 0.000003 Score: 42.4
LFSILKIGAKVIGKNLLKQAGKAGMEYAACKATNQC - 5. L13A025266 From 1 To 37 E-value: 0.000003 Score: 42.4
SIFSLFKAGAKFFGKNLLKEAGKAGAAHLACKATNQC
Structure
- Domains
- 1 Name:Antimicrobial_frog_2 Interpro Link:IPR012521
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: Staphylococcus aureus 209P MIC: 6.25 μg/ml (1.77749 μM)
- 2 Target: Bacillus subtilis ATCC6633 MIC: 6.25 μg/ml (1.77749 μM)
- 3 Target: Micrococcus luteus ATCC9341 MIC: 1.56 μg/ml (0.443661 μM)
- 4 Target: Streptococcus pyogenes COOK MIC: 12.5 μg/ml (3.55497 μM)
- 5 Target: Eschericia coli NIHJ MIC: 12.5 μg/ml (3.55497 μM)
- 6 Target: Pseudomonas aeruginosa PAO-1 MIC: 100 μg/ml (28.4398 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Tatemoto K.,Kagegawa T.,Ohe Y.,Suzuki S.,
- Title:Isolation and characterization of novel antimicrobial peptides, rugosins A, B and C, from the skin of the frog, Rana rugosa.
- Journal:Biochem. Biophys. Res. Commun., 1995, 212, 249-254 [MEDLINE:95336450]
Comments
- Comments
No comments found on LAMP database