Record in detail
General Info
- lamp_id:L01A000289
- Name:RUGC_GLARU
- FullName:Rugosin-C
- Source:Glandirana rugosa
- Mass:3815.5 Da
- Sequence Length:37 aa
- Isoelectric Point:10.14
- Activity:Antibacterial
- Sequence
GILDSFKQFAKGVGKDLIKGAAQGVLSTMSCKLAKTC - Function:Has antibacterial activity against Gram-positive bacteria.
Cross-Linking
- Cross-linking
- 1 Database:APD 93
- 2 Database:CAMP CAMPSQ266
- 3 Database:dbAMP dbAMP_03039
- 4 Database:DRAMP DRAMP01522
- 5 Database:SATPdb satpdb11305
- 6 Database:Uniprot P80956
- 7 Database:AMD RGSNC_RANRU
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000289 From 1 To 37 E-value: 0.000000000000001 Score: 73.6
GILDSFKQFAKGVGKDLIKGAAQGVLSTMSCKLAKTC - 2. L03A000119 From 44 To 80 E-value: 0.00000000000003 Score: 68.9
GILDTLKQFAKGVGKDLVKGAAQGVLSTVSCKLAKTC - 3. L01A000305 From 1 To 37 E-value: 0.00000000000005 Score: 68.2
GILDTLKQFAKGVGKDLVKGAAQGVLSTVSCKLAKTC - 4. L13A023317 From 1 To 37 E-value: 0.0000000000003 Score: 65.5
GILDTLKQFAKGVGKDLVKGAAQGVLSTVSCKLALTC - 5. L11A003082 From 1 To 30 E-value: 0.0000000008 Score: 54.3
GILDTLKQFAKGVGKDLVKGAAQGVLSTVS
Structure
- Domains
- 1 Name:Antimicrobial_frog_2 Interpro Link:IPR012521
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Tatemoto K.,Kagegawa T.,Ohe Y.,Suzuki S.,
- Title:Isolation and characterization of novel antimicrobial peptides, rugosins A, B and C, from the skin of the frog, Rana rugosa.
- Journal:Biochem. Biophys. Res. Commun., 1995, 212, 249-254 [MEDLINE:95336450]
Comments
- Comments
No comments found on LAMP database