Record in detail


General Info

  • lamp_id:L01A000289
  • Name:RUGC_GLARU
  • FullName:Rugosin-C
  • Source:Glandirana rugosa
  • Mass:3815.5 Da
  • Sequence Length:37 aa
  • Isoelectric Point:10.14
  • Activity:Antibacterial
  • Sequence
        GILDSFKQFAKGVGKDLIKGAAQGVLSTMSCKLAKTC
  • Function:Has antibacterial activity against Gram-positive bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000289    From 1 To 37 E-value: 0.000000000000001 Score: 73.6
        GILDSFKQFAKGVGKDLIKGAAQGVLSTMSCKLAKTC
  • 2. L03A000119    From 44 To 80 E-value: 0.00000000000003 Score: 68.9
        GILDTLKQFAKGVGKDLVKGAAQGVLSTVSCKLAKTC
  • 3. L01A000305    From 1 To 37 E-value: 0.00000000000005 Score: 68.2
        GILDTLKQFAKGVGKDLVKGAAQGVLSTVSCKLAKTC
  • 4. L13A023317    From 1 To 37 E-value: 0.0000000000003 Score: 65.5
        GILDTLKQFAKGVGKDLVKGAAQGVLSTVSCKLALTC
  • 5. L11A003082    From 1 To 30 E-value: 0.0000000008 Score: 54.3
        GILDTLKQFAKGVGKDLVKGAAQGVLSTVS

Structure

  •   Domains
  •   1  Name:Antimicrobial_frog_2    Interpro Link:IPR012521
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Tatemoto K.,Kagegawa T.,Ohe Y.,Suzuki S.,
  •   Title:Isolation and characterization of novel antimicrobial peptides, rugosins A, B and C, from the skin of the frog, Rana rugosa.
  •   Journal:Biochem. Biophys. Res. Commun., 1995, 212, 249-254  [MEDLINE:95336450]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: