Record in detail


General Info

  • lamp_id:L01A000298
  • Name:LAP_BOVIN
  • FullName:Lingual antimicrobial peptide
  • Source:Bos taurus
  • Mass:4464.3 Da
  • Sequence Length:40 aa
  • Isoelectric Point:11.44
  • Activity:Antibacterial, Antifungal
  • Sequence
        VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • Function:Shows a broad spectrum of antibacterial and antifungal activities.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001371    From 25 To 64 E-value: 4e-18 Score: 81.6
        VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 2. L01A001519    From 5 To 44 E-value: 2e-17 Score: 79.3
        VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 3. L02A000401    From 6 To 45 E-value: 2e-17 Score: 79.3
        VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 4. L01A000298    From 1 To 40 E-value: 2e-17 Score: 79.3
        VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 5. L11A004351    From 3 To 42 E-value: 3e-17 Score: 79
        VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zasloff M.A.,Stolzenberg E.D.,Schonwetter B.S.,
  •   Title:Epithelial antibiotics induced at sites of inflammation.
  •   Journal:Science, 1995, 267, 1645-1648  [MEDLINE:95192714]
  •   [2]  Bevins C.L.,Scanlin T.F.,Tarver A.P.,Diamond G.,Russell J.P.,
  •   Title:Coordinate induction of two antibiotic genes in tracheal epithelial cells exposed to the inflammatory mediators lipopolysaccharide and tumor necrosis factor alpha.
  •   Journal:Infect. Immun., 1996, 64, 1565-1568  [MEDLINE:96201562]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: