Record in detail

lamp_id:L01A000300
Name:H2A_BUFBG
FullName:Histone H2A
Source:Bufo bufo gargarizans
Mass:4263 Da
Sequence Length:39 aa
Isoelectric Point:12.91
Activity:Antibacterial, Antifungal
Sequence
AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY
Function:Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Top similar AMPs on LAMP
1. L01A000300 From 1 To 39 E-value: 2e-16 Score: 76.3
AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY
2. L11A005547 From 1 To 39 E-value: 4e-16 Score: 75.5
SGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY
3. L12A09319| From 2 To 40 E-value: 0.000000000000005 Score: 71.2
SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNY
4. L12A11014| From 1 To 39 E-value: 0.000000000000005 Score: 71.2
SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNY
5. L12A11013| From 1 To 39 E-value: 0.000000000000006 Score: 71.2
SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNY

Antibacterial Activities
1 Target: Bacillus subtilis MIC: 4 μg/ml (0.938306 μM)
2 Target: Staphylococcus aureus MIC: 4 μg/ml (0.938306 μM)
3 Target: Streptococcus mutans MIC: 8 μg/ml (1.87661 μM)
4 Target: Streptococcus pneumoniae MIC: 4 μg/ml (0.938306 μM)
5 Target: Pseudomonas putida MIC: 4 μg/ml (0.938306 μM)
6 Target: Escherichia coli MIC: 8 μg/ml (1.87661 μM)
7 Target: Salmonella typhimurium MIC: 4 μg/ml (0.938306 μM)
8 Target: Serratia sp. MIC: 8 μg/ml (1.87661 μM)
9 Target: Candida albicans MIC: 4 μg/ml (0.938306 μM)
10 Target: Cryptococcus neoformans MIC: 4 μg/ml (0.938306 μM)
11 Target: Saccharomyces cerevisiae MIC: 4 μg/ml (0.938306 μM)