Record in detail


General Info

  • lamp_id:L01A000305
  • Name:GGN4_GLARU
  • FullName:Gaegurin-4
  • Source:Glandirana rugosa
  • Mass:3749.5 Da
  • Sequence Length:37 aa
  • Isoelectric Point:10.14
  • Activity:Antibacterial, Antifungal, Antiparasitic
  • Sequence
        GILDTLKQFAKGVGKDLVKGAAQGVLSTVSCKLAKTC
  • Function:Has a non-hemolytic activity. Has a broad spectrum of activity against both Gram-positive and Gram-negative bacteria, fungi and protozoa.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000119    From 44 To 80 E-value: 0.000000000000001 Score: 73.6
        GILDTLKQFAKGVGKDLVKGAAQGVLSTVSCKLAKTC
  • 2. L01A000305    From 1 To 37 E-value: 0.000000000000004 Score: 71.6
        GILDTLKQFAKGVGKDLVKGAAQGVLSTVSCKLAKTC
  • 3. L13A023317    From 1 To 37 E-value: 0.00000000000002 Score: 69.3
        GILDTLKQFAKGVGKDLVKGAAQGVLSTVSCKLALTC
  • 4. L01A000289    From 1 To 37 E-value: 0.00000000000005 Score: 68.2
        GILDSFKQFAKGVGKDLIKGAAQGVLSTMSCKLAKTC
  • 5. L11A003082    From 1 To 30 E-value: 0.00000000005 Score: 58.2
        GILDTLKQFAKGVGKDLVKGAAQGVLSTVS

Structure

  •   Domains
  •   1  Name:Antimicrobial_frog_2    Interpro Link:IPR012521
  •   2  Name:Brevinin    Interpro Link:IPR004275
  •   3  Name:EF_Hand_1_Ca_BS    Interpro Link:IPR018247
  •   Structures

Activity

  •   Antibacterial Activities
  •   1  Target:  Micrococcus luteus  MIC:  2.5 μg/ml  (0.666756 μM)  
  •   2  Target:  Staphylococcus epidermidis  MIC:  10 μg/ml  (2.66702 μM)  
  •   3  Target:  Bacillus subtilis  MIC:  10 μg/ml  (2.66702 μM)  
  •   4  Target:  Klebsiella pneumoniae  MIC:  25 μg/ml  (6.66756 μM)  
  •   5  Target:  Shigella dysentariae  MIC:  25 μg/ml  (6.66756 μM)  
  •   6  Target:  Pseudomonas putida  MIC:  100 μg/ml  (26.6702 μM)  
  •   7  Target:  Pseudomonas aeruginosa  MIC:  100 μg/ml  (26.6702 μM)  
  •   8  Target:  Eshchericia coli  MIC:  75 μg/ml  (20.0027 μM)  
  •   9  Target:  Saccharomyces cerevisiae  MIC:  200 μg/ml  (53.3404 μM)  
  •   10  Target:  Candida albicans  MIC:  200 μg/ml  (53.3404 μM)  
  •   11  Target:  Salmonella typhimurium  MIC:  200 μg/ml  (53.3404 μM)  
  •   12  Target:  Proteus mirabilis  MIC:  200 μg/ml  (53.3404 μM)  
  •   13  Target:  Serratia marcescens  MIC:  200 μg/ml  (53.3404 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lee B.J.,Jung J.-E.,Park J.M.,
  •   Title:Antimicrobial peptides from the skin of a Korean frog, Rana rugosa.
  •   Journal:Biochem. Biophys. Res. Commun., 1994, 205, 948-954  [MEDLINE:95091844]
  •   [2]  Lee B.J.,Park J.M.,Carlson B.A.,Kwon S.Y.,
  •   Title:Structural organization and expression of the gaegurin 4 gene of Rana rugosa.
  •   Journal:Biochim. Biophys. Acta, 2000, 1492, 185-190  [MEDLINE:20461774]
  •   [3]  Park Y.H.,Lee S.H.,Kim D.H.,Kim J.S.,Chi S.W.,
  •   Title:Solution structure and membrane interaction mode of an antimicrobial peptide gaegurin 4.
  •   Journal:Biochem. Biophys. Res. Commun., 2007, 352, 592-597  [PubMed:17141187]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: