Record in detail
General Info
- lamp_id:L01A000310
- Name:CECB_HELVI
- FullName:Cecropin-B
- Source:Heliothis virescens
- Mass:3605.3 Da
- Sequence Length:33 aa
- Isoelectric Point:11.42
- Activity:Antibacterial, Antifungal
- Sequence
KWKVFKKIEKVGRNIRDGIVKAGPAIAVLGQAN - Function:Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria. Has also activity against fungi.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ287
- 2 Database:dbAMP dbAMP_05535
- 3 Database:DRAMP DRAMP03497
- 4 Database:SATPdb satpdb26885
- 5 Database:Uniprot P83414
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000310 From 1 To 33 E-value: 0.0000000000003 Score: 65.5
KWKVFKKIEKVGRNIRDGIVKAGPAIAVLGQAN - 2. L12A08746| From 27 To 58 E-value: 0.000000000005 Score: 61.6
RWKVFKKIEKVGRNIRDGILKAGPAIAVLGEA - 3. L03A000216 From 27 To 58 E-value: 0.000000000006 Score: 61.2
RWKVFKKIEKVGRNIRDGVIKAGPAIAVVGQA - 4. L12A08750| From 27 To 58 E-value: 0.000000000006 Score: 61.2
RWKVFKKIEKVGRNVRDGVIKAGPAIAVLGEA - 5. L12A08749| From 27 To 58 E-value: 0.000000000008 Score: 60.8
RWKVFKKIEKVGRNIRDGVIKAGPAIEVLGQA
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database