Record in detail


General Info

  • lamp_id:L01A000315
  • Name:GNK1_GINBI
  • FullName:Antifungal protein ginkbilobin-1
  • Source:Ginkgo biloba
  • Mass:4213.7 Da
  • Sequence Length:40 aa
  • Isoelectric Point:12.22
  • Activity:Antibacterial, Antifungal, Antiviral
  • Sequence
        ANTAFVSSAHNTQKIPAGAPFNRNLRAMLADLRQNAAFAG
  • Function:Possesses antifungal activity against B.cinerea, M.arachidicola, F.oxysporum, R.solani and C.comatus and moderate antibacterial activity against S.aureus, P.aeruginosa and E.coli. Inhibits HIV-1 reverse transcriptase and proliferation of murine splenocytes.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000315    From 1 To 40 E-value: 9e-18 Score: 80.5
        ANTAFVSSAHNTQKIPAGAPFNRNLRAMLADLRQNAAFAG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ng T.B.,Wang H.,
  •   Title:Ginkbilobin, a novel antifungal protein from Ginkgo biloba seeds with sequence similarity to embryo-abundant protein.
  •   Journal:Biochem. Biophys. Res. Commun., 2000, 279, 407-411  [MEDLINE:20568691]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: